Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03430 213 / 1e-70 Ankyrin repeat family protein (.1) AT4G27780 61 / 2e-11 ACBP2 acyl-CoA binding protein 2 (.1) AT5G37500 58 / 3e-10 GORK gated outwardly-rectifying K+ channel, gated outwardly-rectifying K+ channel (.1) AT4G35450 57 / 4e-10 AKR2A, AFT, AKR2 ankyrin repeat-containing protein 2 (.1.2.3.4.5) AT5G20350 57 / 8e-10 TIP1 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT5G53470 56 / 8e-10 ACBP1 acyl-CoA binding protein 1 (.1) AT3G02850 56 / 2e-09 SKOR STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) AT3G24530 54 / 8e-09 AAA-type ATPase family protein / ankyrin repeat family protein (.1) AT2G14255 53 / 1e-08 Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT3G58760 52 / 3e-08 Integrin-linked protein kinase family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037116 [exp] 219 / 4e-73 AT2G03430 284 / 2e-97 Ankyrin repeat family protein (.1) Lus10014522 [exp] 67 / 2e-13 AT5G40160 322 / 3e-109 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Lus10003748 [exp] 65 / 1e-12 AT1G07710 83 / 6e-18 Ankyrin repeat family protein (.1) Lus10028039 [exp] 62 / 1e-11 AT3G02850 60 / 1e-17 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10005910 [exp] 62 / 1e-11 AT4G27780 430 / 3e-151 acyl-CoA binding protein 2 (.1) Lus10032165 [exp] 62 / 2e-11 AT5G40160 293 / 3e-98 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Lus10008037 [exp] 60 / 9e-11 AT5G20350 905 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10015687 [exp] 60 / 1e-10 AT3G02850 1231 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10037694 [exp] 59 / 1e-10 AT3G02850 659 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G161300 [exp] 236 / 2e-79 AT2G03430 356 / 1e-125 Ankyrin repeat family protein (.1) Potri.015G010200 [exp] 70 / 1e-14 AT4G27780 432 / 3e-152 acyl-CoA binding protein 2 (.1) Potri.012G017700 [exp] 65 / 1e-12 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.002G213200 [exp] 63 / 5e-12 AT2G03430 96 / 2e-22 Ankyrin repeat family protein (.1) Potri.013G062000 [exp] 59 / 1e-10 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.004G083300 [exp] 59 / 2e-10 AT3G02850 1268 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Potri.004G210000 [exp] 56 / 1e-09 AT2G17390 418 / 1e-146 ankyrin repeat-containing 2B (.1) Potri.001G295200 [exp] 56 / 2e-09 AT5G40160 317 / 4e-108 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1) Potri.004G210100 [exp] 56 / 2e-09 AT2G17390 430 / 3e-151 ankyrin repeat-containing 2B (.1) Potri.010G185200 [exp] 55 / 4e-09 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [flax] [poplar] Ank PF00023 [flax] [poplar] Ank Ankyrin repeat
Representative CDS sequence Show only first row Show all	>Lus10036968 pacid=23171210 polypeptide=Lus10036968 locus=Lus10036968.g ID=Lus10036968.BGIv1.0 annot-version=v1.0 ATGACCGCCGCTCCCTCCTCCACGTCGCCTCTTCCTCCTCCTCCACGTCGCCTCTTCCTCCGGCCACCCCGAGGGGCGGATGTGAATTTGAAGAACGATG GAGGACGAACTGCGCTCCACTATGCTGCGAGCAAGGGATGGTTGAAGATTGCTGAAGTGTTGATTGCACATGGTGCTAAATTGAACGTGAAGGACAAGGC TTGTAAACTTTACTTGACTGTAGGATGCACACCATTGCATCGAGCAGCGAGTGTCGGGAAGGCGGAGTTGTGCGAATTCTTAGTTGAGGAAGGAGCAGAG GTTGACGCTGTGGATAGAGCTGGTCAAACACCTCTTATGAATGCTGTGATATGCGATAATAGAGAGGTAGCTCTTCTTCTAATAAGGCATGGAGCAGATG TGGATGCGGAGGACAAAGAAGAATACACTGTGCTTGGTCGAGCTTCGCGCGACTTTAGGGATATTCTCATTGATGCTGCAAAAGCCATGCTTGAAGGGTG A
AA sequence Show only first row Show all	>Lus10036968 pacid=23171210 polypeptide=Lus10036968 locus=Lus10036968.g ID=Lus10036968.BGIv1.0 annot-version=v1.0 MTAAPSSTSPLPPPPRRLFLRPPRGADVNLKNDGGRTALHYAASKGWLKIAEVLIAHGAKLNVKDKACKLYLTVGCTPLHRAASVGKAELCEFLVEEGAE VDAVDRAGQTPLMNAVICDNREVALLLIRHGADVDAEDKEEYTVLGRASRDFRDILIDAAKAMLEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G03430			Ankyrin repeat family protein ...		Lus10036968 [exp]	0	1
					Lus10023751 [exp]	1.0	0.8356
AT1G17010			2-oxoglutarate (2OG) and Fe(II...		Lus10030941 [exp]	11.5	0.7866
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Lus10041165 [exp]	19.7	0.7943
					Lus10028940 [exp]	22.1	0.7332
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10018785 [exp]	23.2	0.7316
AT2G43770			Transducin/WD40 repeat-like su...		Lus10003390 [exp]	25.0	0.6909
AT4G39830			Cupredoxin superfamily protein...		Lus10037103 [exp]	25.0	0.6894
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Lus10009834 [exp]	36.2	0.6951
AT3G50420			Pentatricopeptide repeat (PPR)...		Lus10022469 [exp]	36.9	0.7537
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Lus10002810 [exp]	39.6	0.6608

Compare expression of checked genes

Lus10036968 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.