Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48140 132 / 1e-41 B12D protein (.1) AT3G29970 84 / 2e-22 B12D protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015825 [exp] 166 / 6e-55 AT3G48140 150 / 3e-49 B12D protein (.1) Lus10004241 [exp] 120 / 9e-37 AT3G48140 132 / 4e-42 B12D protein (.1) Lus10042151 [exp] 120 / 9e-37 AT3G48140 132 / 4e-42 B12D protein (.1) Lus10035132 [exp] 99 / 3e-28 AT3G29970 112 / 5e-34 B12D protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G055300 [exp] 147 / 2e-46 AT3G48140 132 / 8e-41 B12D protein (.1) Potri.008G179401 [exp] 144 / 2e-46 AT3G48140 137 / 8e-44 B12D protein (.1) Potri.012G074900 [exp] 128 / 8e-40 AT3G48140 137 / 8e-44 B12D protein (.1) Potri.017G098800 [exp] 97 / 2e-27 AT3G29970 131 / 9e-42 B12D protein (.1) Potri.004G117300 [exp] 94 / 2e-26 AT3G29970 126 / 9e-40 B12D protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06522 [flax] [poplar] B12D NADH-ubiquinone reductase complex 1 MLRQ subunit
Representative CDS sequence Show only first row Show all	>Lus10036977 pacid=23171350 polypeptide=Lus10036977 locus=Lus10036977.g ID=Lus10036977.BGIv1.0 annot-version=v1.0 ATGGATTCGACCCGAGGTAACGCCGATCCCCCATGTCTCAATTTTCACTCTGGTTGCTCTGGTTTCTCGATGATAATGATAAAGAAACTCTATTTTGTAC GTCAGGTGTTCCCTCTGTTTGCTTCCGTGGGTGTCGCCGTTGGGATTTGCGGGATGCAGCTCGTCAGGAACATCACTGGCAATCCTGAAGTCAGGGTGAC TAAAGAAAACAGGGCAGCTGGGATTCTTGATAACCATAAAGAAGGTGAGAAGTACAAAGAACATGGGCTGAGGAGGTTCGTTCGTACTAAGCGCCCTGAG ATCATGCCAGGGATCAATGGCTTCTTCTCCGATCCTCAGCTTCCAGGCCGTTGA
AA sequence Show only first row Show all	>Lus10036977 pacid=23171350 polypeptide=Lus10036977 locus=Lus10036977.g ID=Lus10036977.BGIv1.0 annot-version=v1.0 MDSTRGNADPPCLNFHSGCSGFSMIMIKKLYFVRQVFPLFASVGVAVGICGMQLVRNITGNPEVRVTKENRAAGILDNHKEGEKYKEHGLRRFVRTKRPE IMPGINGFFSDPQLPGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48140			B12D protein (.1)		Lus10036977 [exp]	0	1
AT1G35210			unknown protein		Lus10036476 [exp]	3.2	0.9854
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10002450 [exp]	4.4	0.9860
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Lus10015296 [exp]	5.3	0.9798
AT2G18210			unknown protein		Lus10041771 [exp]	11.8	0.9566
AT1G35210			unknown protein		Lus10010343 [exp]	11.9	0.9831
AT2G46620			P-loop containing nucleoside t...		Lus10022362 [exp]	15.0	0.9828
AT3G48140			B12D protein (.1)		Lus10015825 [exp]	16.7	0.9376
AT3G12360		ITN1	INCREASED TOLERANCE TO NACL, A...		Lus10023460 [exp]	18.3	0.9671
AT1G03220			Eukaryotic aspartyl protease f...		Lus10010278 [exp]	18.3	0.9805
AT3G02840			ARM repeat superfamily protein...		Lus10040125 [exp]	21.1	0.9799

Compare expression of checked genes

Lus10036977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.