Lus10036979 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67620 124 / 2e-36 Lojap-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015822 266 / 3e-92 AT1G67620 168 / 2e-53 Lojap-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G105700 164 / 4e-52 AT1G67620 184 / 1e-59 Lojap-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0260 NTP_transf PF02410 RsfS Ribosomal silencing factor during starvation
Representative CDS sequence
>Lus10036979 pacid=23171024 polypeptide=Lus10036979 locus=Lus10036979.g ID=Lus10036979.BGIv1.0 annot-version=v1.0
ATGTTGACGGCTGCTCTCCGATCAAATTTGTCATCCCTCCTCCGCCAGTCATGGCGGCTAGGGTTTCCATGCTCCAATCACGGTCTCTGTTCTTCAACCG
CTCAATCAGAAATAAACAAAAGCGACGGAAGCTTGCTGGAGCTTGGCGAGGTGGAGAAGATTCTCACCGACGTTAGAGCCGATGACGTTAAAGTGATACC
TGCCGGAAATCGCTACGATTGGGTCGATTACATGGTGATTGCCACCGGAAGGTCCACCTGGCATGTCAAGAACATCGCCGAAGCTCTTATTTACAAGGCA
GGTTTGGCTCAGCAAGCTCGAAGGGTGATAGTTCATGCTCTTGATGAGAATGCTAGAACTTACTACAAGTTGGAGAATCTTTGGAATTCAGATAAATCTC
AGAAGGATCCAGCTCAGGATCTAACAAAGGCTTTTGTGAAGATACGACCCAAGAACAATTCTAAGAAGCGAGTGCCGAGCAAATGA
AA sequence
>Lus10036979 pacid=23171024 polypeptide=Lus10036979 locus=Lus10036979.g ID=Lus10036979.BGIv1.0 annot-version=v1.0
MLTAALRSNLSSLLRQSWRLGFPCSNHGLCSSTAQSEINKSDGSLLELGEVEKILTDVRADDVKVIPAGNRYDWVDYMVIATGRSTWHVKNIAEALIYKA
GLAQQARRVIVHALDENARTYYKLENLWNSDKSQKDPAQDLTKAFVKIRPKNNSKKRVPSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67620 Lojap-related protein (.1) Lus10036979 0 1
AT1G22140 unknown protein Lus10025627 5.7 0.8416
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10003760 5.9 0.8344
AT3G11591 unknown protein Lus10016986 7.9 0.8299
AT2G38280 ATAMPD, FAC1 EMBRYONIC FACTOR1, ADENOSINE 5... Lus10005043 8.7 0.7985
AT3G25210 Tetratricopeptide repeat (TPR)... Lus10038215 9.3 0.8368
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030906 10.8 0.8371
AT4G31720 STG1, TAFII15, ... TBP-ASSOCIATED FACTOR 10, SALT... Lus10005077 11.8 0.8347
AT5G57860 Ubiquitin-like superfamily pro... Lus10036598 12.0 0.8227
AT5G55140 ribosomal protein L30 family p... Lus10031912 14.5 0.8265
AT2G18465 Chaperone DnaJ-domain superfam... Lus10020871 17.3 0.7776

Lus10036979 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.