Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24350 186 / 1e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3) AT1G67600 184 / 4e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) AT3G21610 153 / 3e-49 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) AT3G61770 108 / 1e-29 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) AT3G12685 81 / 5e-20 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011373 [exp] 216 / 1e-73 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10006432 [exp] 215 / 3e-73 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10035299 [exp] 152 / 4e-48 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Lus10000883 [exp] 144 / 2e-45 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Lus10003670 [exp] 144 / 5e-45 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Lus10030025 [exp] 136 / 4e-41 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Lus10030253 [exp] 114 / 1e-33 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10014550 [exp] 62 / 9e-14 AT3G61770 115 / 4e-33 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10001841 [exp] 66 / 1e-13 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G056600 [exp] 207 / 6e-70 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Potri.011G087100 [exp] 156 / 6e-50 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Potri.014G156000 [exp] 155 / 1e-49 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Potri.002G226900 [exp] 148 / 1e-46 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Potri.002G171300 [exp] 113 / 1e-31 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Potri.010G176100 [exp] 64 / 3e-13 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0525 [flax] [poplar] pap2 PF02681 [flax] [poplar] DUF212 Divergent PAP2 family
Representative CDS sequence Show only first row Show all	>Lus10036984 pacid=23171035 polypeptide=Lus10036984 locus=Lus10036984.g ID=Lus10036984.BGIv1.0 annot-version=v1.0 ATGAAGCAGCTCCTTGGATCAGGTGGAATGCCTTCTTCCCATTCTGCAACTGTCACTGCACTAGCCATGGCCATTGGCTTCCAGGAAGGGTTCGAAGGAT CTCTTTTCGCTGCTGCGTTGATCCTAGCTTGCGTTGTGATGTATGATGCTACTGGTGTAAGGTTACAGGCTGGCCGGCAAGCAGAGGTGTTGAATCAAAT TGTGTATGAACTCCCTGCTGAACATCCTTTGGCCGAAAGCAGACCTCTTCGTGAACTCCTTGGTCACACTCCTGCTCAGGTTATTGCGGGTAGCTTGCTT GGAGTTGTGACAGCTATCATTGGCCATCTGATCACAATGGCAACTAGTCGCAGCTGA
AA sequence Show only first row Show all	>Lus10036984 pacid=23171035 polypeptide=Lus10036984 locus=Lus10036984.g ID=Lus10036984.BGIv1.0 annot-version=v1.0 MKQLLGSGGMPSSHSATVTALAMAIGFQEGFEGSLFAAALILACVVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHTPAQVIAGSLL GVVTAIIGHLITMATSRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24350			Acid phosphatase/vanadium-depe...		Lus10036984 [exp]	0	1
AT2G28370			Uncharacterised protein family...		Lus10041312 [exp]	1.4	0.8558
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10036577 [exp]	1.4	0.8669
AT5G07120		SNX2b	sorting nexin 2B (.1)		Lus10026403 [exp]	4.2	0.8481
AT2G13560		NAD-ME1	NAD-dependent malic enzyme 1 (...		Lus10018939 [exp]	6.0	0.8080
AT5G53330			Ubiquitin-associated/translati...		Lus10014944 [exp]	10.0	0.8404
AT3G49390		CID10	CTC-interacting domain 10 (.1....		Lus10032942 [exp]	13.2	0.8208
AT2G35120			Single hybrid motif superfamil...		Lus10018319 [exp]	15.0	0.8280
AT1G08820		VAP27-2	vamp/synaptobrevin-associated ...		Lus10033837 [exp]	15.9	0.7699
AT3G49800			BSD domain-containing protein ...		Lus10019271 [exp]	17.1	0.8016
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10011858 [exp]	19.6	0.8168

Compare expression of checked genes

Lus10036984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.