Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13677 81 / 1e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015813 [exp] 153 / 2e-50 AT3G13677 86 / 1e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G406200 [exp] 105 / 1e-31 AT3G13677 81 / 1e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036992 pacid=23171314 polypeptide=Lus10036992 locus=Lus10036992.g ID=Lus10036992.BGIv1.0 annot-version=v1.0 ATGGATATCACATCCACCGTCGCCGTCGCCGCCCCTCAATCTTCTCACGAGTGGAAGCAAATGGTTAGTGAGGAGGAGAAGAAGGCGGTGATTCAGGAAG AGATGAAGAGGATGAATAAGCTTCCGGCAAACAGCAACTACGCCGCCCACCGCCTGCGAGTGCTCAACAAAATCTTGCAGCTCCTCTCTGTACCCAGGAC CATCTCTCAGGATGAGGAGCTCGAGTTGCTCTTCGCCGGCCTCCGTCTGTAA
AA sequence Show only first row Show all	>Lus10036992 pacid=23171314 polypeptide=Lus10036992 locus=Lus10036992.g ID=Lus10036992.BGIv1.0 annot-version=v1.0 MDITSTVAVAAPQSSHEWKQMVSEEEKKAVIQEEMKRMNKLPANSNYAAHRLRVLNKILQLLSVPRTISQDEELELLFAGLRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13677			unknown protein		Lus10036992 [exp]	0	1
AT4G00950		MEE47	maternal effect embryo arrest ...		Lus10030238 [exp]	9.4	0.6399
AT4G40045			unknown protein		Lus10034155 [exp]	24.2	0.6375
AT1G65720			unknown protein		Lus10020795 [exp]	25.9	0.6323
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	34.3	0.6239
AT4G11560			bromo-adjacent homology (BAH) ...		Lus10008527 [exp]	45.7	0.5981
AT2G25720			unknown protein		Lus10032479 [exp]	54.4	0.5961
AT5G49210			unknown protein		Lus10043148 [exp]	96.4	0.5464
AT5G19910		MED31	SOH1 family protein (.1.2)		Lus10021434 [exp]	111.5	0.5506

Compare expression of checked genes

Lus10036992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.