Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67590 51 / 1e-08 Remorin family protein (.1.2) AT2G02170 41 / 5e-05 Remorin family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015817 [exp] 176 / 6e-55 AT1G67590 280 / 5e-92 Remorin family protein (.1.2) Lus10041239 [exp] 135 / 3e-41 AT1G67590 72 / 6e-15 Remorin family protein (.1.2) Lus10032549 [exp] 43 / 2e-05 AT5G50850 628 / 0.0 MACCI-BOU, Transketolase family protein (.1) Lus10038521 [exp] 40 / 0.0002 AT1G30320 128 / 4e-34 Remorin family protein (.1) Lus10026481 [exp] 0 / 1 AT1G67590 63 / 2e-12 Remorin family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G178300 [exp] 91 / 6e-23 AT1G67590 306 / 1e-102 Remorin family protein (.1.2) Potri.010G056800 [exp] 91 / 1e-22 AT1G67590 253 / 8e-82 Remorin family protein (.1.2) Potri.008G144300 [exp] 40 / 0.0001 AT2G02170 431 / 5e-147 Remorin family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036997 pacid=23171320 polypeptide=Lus10036997 locus=Lus10036997.g ID=Lus10036997.BGIv1.0 annot-version=v1.0 ATGAGATCTATAGAAGATAAGAGTTGCTACAGCAATGGAGCAACGACGCCGGTTCATAATCAGCAAGAGATTCCTAGCAGCAATGGAGCAATCAGCTTCG AGTTTCATAAAGGTAGCAGAACCGACAAGACTTCTTCTTCAGCTAGGAATAATCACCGTCAGCAGCACCACAGGATCGCGTTGGGGAAGCCGACGCCGTC CAAATGGGACGACGCGCAGAAATGGCTGGTGGGGTTATCGAGAGGCGGCGCTGGTGGAGGGGGAGGGGATAAGAATCAGATCCTTTGGGAGGGTGGGGTG AAAGGATCGAACTCACGCACCCCGAGAATTGGAACGCCGACGATCGGCGGTTGA
AA sequence Show only first row Show all	>Lus10036997 pacid=23171320 polypeptide=Lus10036997 locus=Lus10036997.g ID=Lus10036997.BGIv1.0 annot-version=v1.0 MRSIEDKSCYSNGATTPVHNQQEIPSSNGAISFEFHKGSRTDKTSSSARNNHRQQHHRIALGKPTPSKWDDAQKWLVGLSRGGAGGGGGDKNQILWEGGV KGSNSRTPRIGTPTIGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67590			Remorin family protein (.1.2)		Lus10036997 [exp]	0	1
AT3G05470			Actin-binding FH2 (formin homo...		Lus10029897 [exp]	1.7	0.9008
AT1G67590			Remorin family protein (.1.2)		Lus10015817 [exp]	3.0	0.8941
AT3G58100		PDCB5	plasmodesmata callose-binding ...		Lus10039907 [exp]	7.2	0.8993
AT5G26230		MAKR1	membrane-associated kinase reg...		Lus10041214 [exp]	8.1	0.8665
AT5G49665			Zinc finger (C3HC4-type RING f...		Lus10042930 [exp]	11.0	0.8670
AT3G10050		OMR1	L-O-methylthreonine resistant ...		Lus10014390 [exp]	11.2	0.8640
AT5G65700		BAM1	BARELY ANY MERISTEM 1, Leucine...		Lus10019248 [exp]	15.0	0.8896
AT3G28040			Leucine-rich receptor-like pro...		Lus10037276 [exp]	15.2	0.8695
AT3G16490		IQD26	IQ-domain 26 (.1)		Lus10043033 [exp]	20.1	0.8914
AT1G11800			endonuclease/exonuclease/phosp...		Lus10020021 [exp]	20.3	0.8858

Compare expression of checked genes

Lus10036997 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.