Lus10037002 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 211 / 1e-69 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 67 / 5e-14 Cysteine proteinases superfamily protein (.1)
AT2G27350 46 / 4e-06 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT1G50670 43 / 2e-05 OTU-like cysteine protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015803 292 / 2e-103 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10020438 223 / 2e-73 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986 177 / 1e-55 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10028840 178 / 7e-55 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027758 53 / 7e-09 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10005193 48 / 9e-07 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10006255 42 / 9e-05 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G177400 241 / 7e-83 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G050900 226 / 3e-74 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G057400 216 / 1e-70 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G026100 183 / 4e-58 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.010G234300 182 / 1e-57 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400 74 / 1e-16 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.010G057750 58 / 5e-12 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.009G160100 49 / 4e-07 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.004G196800 42 / 8e-05 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 41 / 0.0002 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10037002 pacid=23171317 polypeptide=Lus10037002 locus=Lus10037002.g ID=Lus10037002.BGIv1.0 annot-version=v1.0
ATGGATTGTGGGTTAGGTTGGTTCTTGAATTTCTGGATACCAGGAGATGGGAGGTGCTTGTTCAGGTCCGTAGCTCACGGTGCTTGTCTTCGAGCGGGGA
AGCCATCCCCTAGCGAAACCGTCGAGAAAGAACTTGCTGATGAGCTCAGAGATGAGGTTGCTGACGAGTTCATCAAGAGAAGGAAGGAGACTGAATGGTT
CATTGAGGATGATTTTGATGAATATGTTGGACACATGAGACAGCCTCATGTCTGGGGAGGAGAGCCTGAGCTACTTATGTCCTCTCATGTCCTAAAGACG
CCGATCTCTGTTTACATGAACGATAAGAGCTCCGGAACCCTGAAGGTTATAGCAGAATATGGCCAGGAGTATGGGAAGGATGTCCCGATTCGTGTACTGT
ACCATGGTTATGGCCATTACGATGCTCTTCGAAGCTCGGTCTCCAGTTCGGAATCGAAACCGTGA
AA sequence
>Lus10037002 pacid=23171317 polypeptide=Lus10037002 locus=Lus10037002.g ID=Lus10037002.BGIv1.0 annot-version=v1.0
MDCGLGWFLNFWIPGDGRCLFRSVAHGACLRAGKPSPSETVEKELADELRDEVADEFIKRRKETEWFIEDDFDEYVGHMRQPHVWGGEPELLMSSHVLKT
PISVYMNDKSSGTLKVIAEYGQEYGKDVPIRVLYHGYGHYDALRSSVSSSESKP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57810 Cysteine proteinases superfami... Lus10037002 0 1
AT4G10955 alpha/beta-Hydrolases superfam... Lus10001819 4.5 0.8666
AT2G17700 STY8 serine/threonine/tyrosine kina... Lus10004153 9.1 0.8728
AT1G07400 HSP20-like chaperones superfam... Lus10022604 9.4 0.8718
AT2G24220 ATPUP5 purine permease 5 (.1.2) Lus10022148 9.5 0.8416
AT5G06800 GARP myb-like HTH transcriptional r... Lus10023816 10.5 0.8713
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Lus10021035 11.8 0.8669
AT5G25752 ATRBL11 ARABIDOPSIS RHOMBOID-LIKE PROT... Lus10022131 12.4 0.7573
AT3G10300 Calcium-binding EF-hand family... Lus10031049 13.2 0.8174
AT1G77290 Glutathione S-transferase fami... Lus10042756 15.5 0.8393
Lus10005647 16.5 0.7274

Lus10037002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.