Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015798 [exp] 183 / 9e-62 ND / Lus10006424 [exp] 108 / 3e-32 ND / Lus10011367 [exp] 107 / 9e-32 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G058400 [exp] 96 / 2e-26 ND / Potri.008G176700 [exp] 74 / 4e-18 ND / Potri.010G058600 [exp] 55 / 6e-11 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037007 pacid=23171291 polypeptide=Lus10037007 locus=Lus10037007.g ID=Lus10037007.BGIv1.0 annot-version=v1.0 ATGGGTAGCATGAAAGGCGTCGACGAAACTGCGGCGAGGGGGGCTAGGAGCTTCCGAAATGAGGATTACAGCTACAGGAGGGTGTTTCTGAGGAGCTATC CGCTTCACTGGGAAGGAGATGACGACACAAGTTACGAAGAAGAAGAAGACATGATCCGGTCTACAGAGAAGCACGATCAGAAGAAACTCATGAAGAAGAT GATGCGGTCGATGTTTCAGTGGGGGGAAGCTAGGGTTCTGGTTCTGAGGAGATTCAAGCATAAGGTTAGAGTTTACGTCGTAAGTCGTATCCTTGTTGGC TACTAG
AA sequence Show only first row Show all	>Lus10037007 pacid=23171291 polypeptide=Lus10037007 locus=Lus10037007.g ID=Lus10037007.BGIv1.0 annot-version=v1.0 MGSMKGVDETAARGARSFRNEDYSYRRVFLRSYPLHWEGDDDTSYEEEEDMIRSTEKHDQKKLMKKMMRSMFQWGEARVLVLRRFKHKVRVYVVSRILVG Y

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037007 [exp]	0	1
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030085 [exp]	3.5	0.8344
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030086 [exp]	5.1	0.7441
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Lus10016115 [exp]	7.4	0.7791
AT1G62340		ALE1	ABNORMAL LEAF-SHAPE 1, ABNORMA...		Lus10015559 [exp]	13.4	0.7787
AT3G02220			unknown protein		Lus10043249 [exp]	14.0	0.7919
AT1G66930			Protein kinase superfamily pro...		Lus10022367 [exp]	14.7	0.7869
					Lus10004778 [exp]	21.6	0.7893
AT5G52390			PAR1 protein (.1)		Lus10040702 [exp]	22.8	0.6911
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Lus10035930 [exp]	24.4	0.7340
AT5G62140			unknown protein		Lus10038887 [exp]	26.3	0.7766

Compare expression of checked genes

Lus10037007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.