Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G40042 111 / 1e-33 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) AT2G22425 99 / 8e-29 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037014 [exp] 148 / 5e-48 AT4G40042 131 / 2e-41 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10015793 [exp] 146 / 3e-47 AT4G40042 127 / 2e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10011365 [exp] 71 / 1e-17 AT4G40042 75 / 2e-19 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10006422 [exp] 67 / 5e-16 AT4G40042 66 / 1e-15 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G175775 [exp] 120 / 4e-37 AT2G22425 124 / 1e-38 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2) Potri.010G059300 [exp] 114 / 9e-35 AT4G40042 119 / 7e-37 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06645 [flax] [poplar] SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12)
Representative CDS sequence Show only first row Show all	>Lus10037011 pacid=23171169 polypeptide=Lus10037011 locus=Lus10037011.g ID=Lus10037011.BGIv1.0 annot-version=v1.0 ATGGATTGCCAAGGGCAGAAAGTGGCGGAGCAGCTGATGCAGCTGATGCTGCTGGCCTTCGCGGCGATCGGATTTGTCTCCGGATACATCACGGGATCGT TCCAGACCATGATCTTGATCTACGCCGGTGGAGTGGTTCTCACCGCGCTGACCGTCGTCCCGAACTGGCCTTGCTTCAATCGCCACCCTCTCCGATGGCT GGATCCCGTCGAGGCCGAGAAGCACCCCAAGCCAGCTCAGACCGTCGCCTCCTCTGCTGCTTCTTCTTCCAAGAAGAGCAAAGCTAAAAAGTAG
AA sequence Show only first row Show all	>Lus10037011 pacid=23171169 polypeptide=Lus10037011 locus=Lus10037011.g ID=Lus10037011.BGIv1.0 annot-version=v1.0 MDCQGQKVAEQLMQLMLLAFAAIGFVSGYITGSFQTMILIYAGGVVLTALTVVPNWPCFNRHPLRWLDPVEAEKHPKPAQTVASSAASSSKKSKAKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G40042			Microsomal signal peptidase 12...		Lus10037011 [exp]	0	1
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10004400 [exp]	11.0	0.7233
AT2G34585			unknown protein		Lus10023307 [exp]	14.2	0.6974
AT4G40042			Microsomal signal peptidase 12...		Lus10037014 [exp]	16.5	0.6579
AT2G19270			unknown protein		Lus10020014 [exp]	27.7	0.6578
AT1G78800			UDP-Glycosyltransferase superf...		Lus10037008 [exp]	67.1	0.5657
AT2G28720			Histone superfamily protein (....		Lus10017456 [exp]	83.4	0.6464
AT2G16710			Iron-sulphur cluster biosynthe...		Lus10021368 [exp]	89.7	0.6254
					Lus10015452 [exp]	100.4	0.5836
AT1G72020			unknown protein		Lus10009443 [exp]	136.2	0.5899
AT5G18800			Cox19-like CHCH family protein...		Lus10012784 [exp]	162.8	0.5968

Compare expression of checked genes

Lus10037011 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.