Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G40042 97 / 1e-27 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) AT2G22425 83 / 4e-22 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037011 [exp] 126 / 3e-39 AT4G40042 127 / 1e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10015793 [exp] 125 / 8e-39 AT4G40042 127 / 2e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10011365 [exp] 61 / 1e-13 AT4G40042 75 / 2e-19 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10006422 [exp] 52 / 2e-10 AT4G40042 66 / 1e-15 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G175775 [exp] 104 / 7e-31 AT2G22425 124 / 1e-38 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2) Potri.010G059300 [exp] 100 / 7e-29 AT4G40042 119 / 7e-37 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06645 [flax] [poplar] SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12)
Representative CDS sequence Show only first row Show all	>Lus10037014 pacid=23171212 polypeptide=Lus10037014 locus=Lus10037014.g ID=Lus10037014.BGIv1.0 annot-version=v1.0 ATGGATTGGCAAGGGCAGAAAGTGGCGGAGCAGCTGATGCAGCTCATGCTGCTGGCCTTCGCGGCGATCGGATTTGTCACCGGATACATCACGGGATCGT TCCAGACCATGATCTTGATCTACGCCGGCGGAGTGGTTCTCACCGCGCTGGCCGTCGTCCCGAACTGGCCTTGCTTCAATCGCCACCCTCTCCGGTGGCT GGATCCCGTCGAGGCCGAGAAGCACCCCAAGCCAGCTCAGACCGTCACCTCTTCTGCTGCTTCTGCTTCCAAGAAGAGCAAAGCTAAGAAGTAG
AA sequence Show only first row Show all	>Lus10037014 pacid=23171212 polypeptide=Lus10037014 locus=Lus10037014.g ID=Lus10037014.BGIv1.0 annot-version=v1.0 MDWQGQKVAEQLMQLMLLAFAAIGFVTGYITGSFQTMILIYAGGVVLTALAVVPNWPCFNRHPLRWLDPVEAEKHPKPAQTVTSSAASASKKSKAKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G40042			Microsomal signal peptidase 12...		Lus10037014 [exp]	0	1
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Lus10006747 [exp]	12.5	0.7348
					Lus10018015 [exp]	16.2	0.7270
AT4G40042			Microsomal signal peptidase 12...		Lus10037011 [exp]	16.5	0.6579
AT3G61320			Bestrophin-like protein (.1)		Lus10037849 [exp]	17.9	0.7154
AT5G62440			Protein of unknown function (D...		Lus10024824 [exp]	26.4	0.5654
AT3G62580			Late embryogenesis abundant pr...		Lus10010016 [exp]	33.6	0.6901
AT3G12630		SAP5	stress associated protein 5, A...		Lus10037702 [exp]	37.3	0.6990
AT1G67350			unknown protein		Lus10015785 [exp]	47.0	0.6670
AT4G24370			unknown protein		Lus10010164 [exp]	55.6	0.6654
AT5G55670			RNA-binding (RRM/RBD/RNP motif...		Lus10038757 [exp]	55.7	0.6160

Compare expression of checked genes

Lus10037014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.