Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43260 93 / 4e-26 chaperone protein dnaJ-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015783 [exp] 143 / 6e-46 AT5G43260 135 / 4e-43 chaperone protein dnaJ-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G171800 [exp] 87 / 5e-24 AT5G43260 152 / 1e-49 chaperone protein dnaJ-related (.1) Potri.001G056601 [exp] 81 / 2e-21 AT5G43260 145 / 4e-47 chaperone protein dnaJ-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037022 pacid=23171209 polypeptide=Lus10037022 locus=Lus10037022.g ID=Lus10037022.BGIv1.0 annot-version=v1.0 ATGGTGCCGATGGTGTTGACCGGAATCAGCGTGCTCGCCGGGGCGGCGGTGGCAAAGTCTTTGCTGGAGCAGAAGCCCATGTCGAGTCAGTTCCAGCCCA GGTGCCCATCCTGCAACGGAACGGGTCGGGTGGAATGCATGTGTTCGAGATGGTCCGATGGGGACGTGGGTTGTCGGAGCTGCGCTGGGTCGGGGCGGAC GGGCTGCAGCAGCTGTGGCGGGTCGGGGACTGGGAGGCCTCTTCCAGTTCAAATCAGGATGCAGTCGCCCAACCGATATGGGTCGGATTGA
AA sequence Show only first row Show all	>Lus10037022 pacid=23171209 polypeptide=Lus10037022 locus=Lus10037022.g ID=Lus10037022.BGIv1.0 annot-version=v1.0 MVPMVLTGISVLAGAAVAKSLLEQKPMSSQFQPRCPSCNGTGRVECMCSRWSDGDVGCRSCAGSGRTGCSSCGGSGTGRPLPVQIRMQSPNRYGSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43260			chaperone protein dnaJ-related...		Lus10037022 [exp]	0	1
AT2G21970		SEP2	stress enhanced protein 2 (.1)		Lus10036629 [exp]	2.2	0.8924
AT2G21970		SEP2	stress enhanced protein 2 (.1)		Lus10035846 [exp]	6.0	0.8924
					Lus10040145 [exp]	6.5	0.8498
AT1G68660			Ribosomal protein L12/ ATP-dep...		Lus10041479 [exp]	9.2	0.8786
AT1G61930			Protein of unknown function, D...		Lus10020047 [exp]	10.1	0.8888
AT1G78600	CO	BBX22, DBB3, ST...	SALT TOLERANCE HOMOLOG 3, DOUB...		Lus10042498 [exp]	10.1	0.8172
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017076 [exp]	10.4	0.8158
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10042672 [exp]	11.2	0.8557
AT3G53810			Concanavalin A-like lectin pro...		Lus10016507 [exp]	11.4	0.8558
AT3G21150	CO	EIP6, BBX32	EMF1-Interacting Protein 1, B-...		Lus10034830 [exp]	11.5	0.8567

Compare expression of checked genes

Lus10037022 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.