Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27330 90 / 1e-25 Ribosome associated membrane protein RAMP4 (.1) AT1G27350 90 / 1e-25 Ribosome associated membrane protein RAMP4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011355 [exp] 82 / 9e-23 AT1G27350 108 / 2e-33 Ribosome associated membrane protein RAMP4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G171100 [exp] 88 / 5e-25 AT1G27330 121 / 3e-38 Ribosome associated membrane protein RAMP4 (.1) Potri.006G017100 [exp] 86 / 5e-24 AT1G27330 119 / 2e-37 Ribosome associated membrane protein RAMP4 (.1) Potri.001G057300 [exp] 79 / 2e-21 AT1G27330 116 / 3e-36 Ribosome associated membrane protein RAMP4 (.1) Potri.016G008600 [exp] 76 / 5e-20 AT1G27330 72 / 2e-18 Ribosome associated membrane protein RAMP4 (.1) Potri.001G057150 [exp] 71 / 2e-18 AT1G27330 99 / 4e-29 Ribosome associated membrane protein RAMP4 (.1) Potri.003G171250 [exp] 42 / 3e-07 AT1G27330 73 / 2e-19 Ribosome associated membrane protein RAMP4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06624 [flax] [poplar] RAMP4 Ribosome associated membrane protein RAMP4
Representative CDS sequence Show only first row Show all	>Lus10037031 pacid=23171138 polypeptide=Lus10037031 locus=Lus10037031.g ID=Lus10037031.BGIv1.0 annot-version=v1.0 ATGCAGACAACGTCAAAGAGGCTAGCAGATAGGAAGATTTCAAAGTTTCAGAAGAACATCACGAGGAGAGGAGCTGTTCCTGAAACAACTGCCAAGAAGG GCAAGGATTACCCTGTTGGCCCTTTCCTCCTTGGGTTCTTCGTCTTCGTCGTCATTGGATCATCTCTGTTCCAGATAATCAGGACGGCAACAAGTGGAGG CATGGCTTAA
AA sequence Show only first row Show all	>Lus10037031 pacid=23171138 polypeptide=Lus10037031 locus=Lus10037031.g ID=Lus10037031.BGIv1.0 annot-version=v1.0 MQTTSKRLADRKISKFQKNITRRGAVPETTAKKGKDYPVGPFLLGFFVFVVIGSSLFQIIRTATSGGMA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27350			Ribosome associated membrane p...		Lus10037031 [exp]	0	1
AT4G18372			Small nuclear ribonucleoprotei...		Lus10042823 [exp]	1.0	0.8649
AT2G37975			Yos1-like protein (.1)		Lus10000226 [exp]	2.4	0.8592
AT3G02950		AtTHO7	Tho complex subunit 7/Mft1p (....		Lus10012882 [exp]	2.8	0.7749
AT5G64920		CIP8	COP1-interacting protein 8 (.1...		Lus10031422 [exp]	5.7	0.8108
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	6.9	0.7967
AT5G14740		BETACA2, CA18, ...	CARBONIC ANHYDRASE 18, BETA CA...		Lus10030874 [exp]	9.2	0.7505
AT5G22060		ATJ2	ARABIDOPSIS THALIANA DNAJ HOMO...		Lus10008652 [exp]	9.9	0.7771
AT5G47200		AtRABD2b, AtRab...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004361 [exp]	14.8	0.7478
AT5G04000			unknown protein		Lus10042034 [exp]	15.6	0.7685
AT5G41685			Mitochondrial outer membrane t...		Lus10001641 [exp]	15.9	0.7427

Compare expression of checked genes

Lus10037031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.