Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27970 231 / 4e-80 NTF2B nuclear transport factor 2B (.1.2) AT1G27310 221 / 3e-76 NTF2A nuclear transport factor 2A (.1) AT1G11570 149 / 2e-47 NTL NTF2-like (.1.2) AT5G48650 56 / 5e-10 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT5G60980 55 / 1e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G13730 52 / 1e-08 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT3G25150 49 / 2e-07 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G07250 40 / 0.0001 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032033 [exp] 241 / 4e-84 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2) Lus10015772 [exp] 206 / 5e-70 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1) Lus10035202 [exp] 191 / 4e-64 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1) Lus10020061 [exp] 152 / 6e-49 AT1G11570 171 / 3e-56 NTF2-like (.1.2) Lus10006762 [exp] 112 / 2e-33 AT1G11570 130 / 2e-40 NTF2-like (.1.2) Lus10036918 [exp] 59 / 4e-11 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10037066 [exp] 59 / 5e-11 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10004644 [exp] 56 / 5e-10 AT2G03640 253 / 2e-79 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10026668 [exp] 56 / 6e-10 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G057500 [exp] 238 / 6e-83 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2) Potri.003G170800 [exp] 232 / 1e-80 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2) Potri.011G025500 [exp] 160 / 1e-51 AT1G11570 171 / 5e-56 NTF2-like (.1.2) Potri.010G157800 [exp] 59 / 4e-11 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.008G096700 [exp] 58 / 7e-11 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.017G094600 [exp] 56 / 5e-10 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G246600 [exp] 55 / 1e-09 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 50 / 5e-08 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G257000 [exp] 42 / 4e-05 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 42 / 4e-05 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10037033 pacid=23171019 polypeptide=Lus10037033 locus=Lus10037033.g ID=Lus10037033.BGIv1.0 annot-version=v1.0 ATGAATCCAGACGCAGTGGCCAAGGCATTCGTAGATCACTACTACAGTACTTTCGACACCAACCGGGCTGGACTGGCTAACCTTTACCAGGATGGCTCCA TGCTCACCTTCGAAGGCCAGCAGATCCAGGGCTCCCAAAACATAGTCGCTAAGCTTACGAGCCTTCCTTTCCAGCAGTGCCAGCACAGCATCACCACCGT CGATTGCCAGCCCTCTGGTCCTGCCGGCGGGATGCTTGTCTTTGTCTCTGGTAACCTTCAGCTCTCCGGGGAACAGCACGCTCTCAAGTTTAGCCAGATG TTCCATTTGATGCCAACTCCACAAGGAAGCTTCTATGTGTTCAACGACATTTTCCGGTTGAACTATGCCTGA
AA sequence Show only first row Show all	>Lus10037033 pacid=23171019 polypeptide=Lus10037033 locus=Lus10037033.g ID=Lus10037033.BGIv1.0 annot-version=v1.0 MNPDAVAKAFVDHYYSTFDTNRAGLANLYQDGSMLTFEGQQIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLSGEQHALKFSQM FHLMPTPQGSFYVFNDIFRLNYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10037033 [exp]	0	1
AT4G22580			Exostosin family protein (.1)		Lus10028924 [exp]	4.2	0.8987
AT1G29790			S-adenosyl-L-methionine-depend...		Lus10025384 [exp]	5.1	0.8985
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Lus10042201 [exp]	5.9	0.8796
AT2G15570		TRX-M3, GAT1, A...	THIOREDOXIN-M3, GFP ARRESTED T...		Lus10014069 [exp]	6.0	0.8837
AT3G44150			unknown protein		Lus10016181 [exp]	8.5	0.8775
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10000536 [exp]	9.2	0.8579
AT3G46550		FLA4, SOS5	salt overly sensitive 5, fasci...		Lus10040821 [exp]	9.5	0.8684
AT3G46550		FLA4, SOS5	salt overly sensitive 5, fasci...		Lus10016554 [exp]	11.0	0.8706
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10028449 [exp]	11.5	0.8331
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10007533 [exp]	12.3	0.8816

Compare expression of checked genes

Lus10037033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.