Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) AT3G48660 102 / 1e-30 Protein of unknown function (DUF 3339) (.1) AT3G27030 100 / 3e-29 unknown protein AT5G63500 96 / 2e-28 Protein of unknown function (DUF 3339) (.1) AT3G27027 88 / 4e-25 Protein of unknown function (DUF 3339) (.1) AT5G14110 86 / 4e-24 Protein of unknown function (DUF 3339) (.1) AT3G01950 86 / 4e-24 Protein of unknown function (DUF 3339) (.1) AT5G40980 78 / 4e-21 Protein of unknown function (DUF 3339) (.1) AT5G40970 78 / 6e-21 Protein of unknown function (DUF 3339) (.1) AT5G50660 65 / 6e-16 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015770 [exp] 138 / 7e-45 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 104 / 1e-31 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10035201 [exp] 104 / 2e-31 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10032032 [exp] 104 / 2e-31 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 103 / 4e-31 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 97 / 2e-28 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 96 / 7e-28 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10041551 [exp] 94 / 3e-27 AT3G27030 113 / 3e-34 unknown protein Lus10012542 [exp] 94 / 3e-27 AT3G27030 113 / 3e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170500 [exp] 123 / 4e-39 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 119 / 2e-37 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 115 / 5e-36 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 111 / 3e-34 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 101 / 3e-30 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 96 / 5e-28 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 91 / 4e-26 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 87 / 9e-25 AT3G27030 79 / 2e-20 unknown protein Potri.001G058001 [exp] 86 / 4e-24 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 87 / 7e-24 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10037035 pacid=23171162 polypeptide=Lus10037035 locus=Lus10037035.g ID=Lus10037035.BGIv1.0 annot-version=v1.0 ATGTCGGACTGGGGCCCAGTGTTCGTGGCGATGGTGCTGTTCGTGCTGCTAACACCAGGGCTGCTGTTTCAGGTGCCGGGTCGGAACCGCTGTATCGAGT TTGGGAATTTCCAGACAAGTGGCGCCGCCATTCTCATCCATTCACTTCTCTACTTTGCACTCGCCTGCGTCTTCTTGCTTGCTATTAAGGTTCATTTTTA TCTTGGTTAA
AA sequence Show only first row Show all	>Lus10037035 pacid=23171162 polypeptide=Lus10037035 locus=Lus10037035.g ID=Lus10037035.BGIv1.0 annot-version=v1.0 MSDWGPVFVAMVLFVLLTPGLLFQVPGRNRCIEFGNFQTSGAAILIHSLLYFALACVFLLAIKVHFYLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08391			Protein of unknown function (D...		Lus10037035 [exp]	0	1
AT1G23410			Ribosomal protein S27a / Ubiqu...		Lus10013082 [exp]	1.4	0.8104
AT1G13710		CYP78A5, KLUH	KLUH, "cytochrome P450, family...		Lus10015788 [exp]	5.8	0.7502
AT5G51330		DYAD, SWI1	SWITCH1 (.1)		Lus10009021 [exp]	6.7	0.7477
AT1G78960		ATLUP2	lupeol synthase 2 (.1)		Lus10019674 [exp]	8.7	0.6213
AT4G33985			Protein of unknown function (D...		Lus10002400 [exp]	10.2	0.7241
AT2G25010			Aminotransferase-like, plant m...		Lus10008761 [exp]	15.2	0.6890
					Lus10010117 [exp]	16.2	0.6890
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025408 [exp]	17.0	0.6890
					Lus10005187 [exp]	17.9	0.6890
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10040338 [exp]	18.7	0.6890

Compare expression of checked genes

Lus10037035 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.