Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48660 85 / 2e-23 Protein of unknown function (DUF 3339) (.1) AT5G63500 81 / 4e-22 Protein of unknown function (DUF 3339) (.1) AT5G40980 80 / 1e-21 Protein of unknown function (DUF 3339) (.1) AT3G27027 77 / 1e-20 Protein of unknown function (DUF 3339) (.1) AT5G08391 76 / 4e-20 Protein of unknown function (DUF 3339) (.1) AT3G27030 74 / 2e-18 unknown protein AT5G40970 68 / 5e-17 Protein of unknown function (DUF 3339) (.1) AT3G01950 66 / 3e-16 Protein of unknown function (DUF 3339) (.1) AT5G14110 64 / 1e-15 Protein of unknown function (DUF 3339) (.1) AT3G01940 59 / 2e-13 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015769 [exp] 101 / 3e-30 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 84 / 3e-23 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 82 / 9e-23 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10012542 [exp] 77 / 1e-20 AT3G27030 113 / 3e-34 unknown protein Lus10041551 [exp] 77 / 1e-20 AT3G27030 113 / 3e-34 unknown protein Lus10037035 [exp] 76 / 3e-20 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 76 / 3e-20 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10012543 [exp] 76 / 9e-20 ND 100 / 2e-29 Lus10035199 [exp] 75 / 9e-20 AT3G27030 108 / 4e-32 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G170400 [exp] 89 / 2e-25 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 81 / 1e-21 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 78 / 6e-21 AT3G27030 111 / 2e-33 unknown protein Potri.001G329000 [exp] 78 / 7e-21 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 77 / 9e-21 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 77 / 1e-20 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 76 / 2e-20 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G328800 [exp] 75 / 7e-20 AT3G27030 79 / 2e-20 unknown protein Potri.001G058001 [exp] 74 / 5e-19 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.017G064972 [exp] 72 / 8e-19 AT3G27027 108 / 3e-33 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10037036 pacid=23171250 polypeptide=Lus10037036 locus=Lus10037036.g ID=Lus10037036.BGIv1.0 annot-version=v1.0 ATGGCGGATTGGGGGCCGGTAGTAATAGCAGTGGTGCTGTTCGTACTGCTGAGTCCAGGGTTGCTGTTCCAGCTACCTGGGAGAGACAGAGTGGTTGAGT TTGGGAAAATGCACACAAGTGGGATGTCCATATTAGTCCACACCATCATTTTCTTTGGACTCATCACCATCTTCTTGATCGCCATTGGAGTCCATATCAA CACTGGATGA
AA sequence Show only first row Show all	>Lus10037036 pacid=23171250 polypeptide=Lus10037036 locus=Lus10037036.g ID=Lus10037036.BGIv1.0 annot-version=v1.0 MADWGPVVIAVVLFVLLSPGLLFQLPGRDRVVEFGKMHTSGMSILVHTIIFFGLITIFLIAIGVHINTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48660			Protein of unknown function (D...		Lus10037036 [exp]	0	1
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10024583 [exp]	2.2	0.9187
AT3G22490			Seed maturation protein (.1)		Lus10042604 [exp]	6.9	0.8504
AT1G30110		ATNUDX25	nudix hydrolase homolog 25 (.1...		Lus10003714 [exp]	8.7	0.8926
AT1G12440			A20/AN1-like zinc finger famil...		Lus10008912 [exp]	11.0	0.8949
AT2G32510		MAPKKK17	mitogen-activated protein kina...		Lus10035284 [exp]	13.9	0.8320
AT3G47160			RING/U-box superfamily protein...		Lus10006447 [exp]	16.7	0.8538
AT4G21865			unknown protein		Lus10014471 [exp]	17.0	0.8556
AT1G27300			unknown protein		Lus10015771 [exp]	20.0	0.8372
AT3G47160			RING/U-box superfamily protein...		Lus10011390 [exp]	24.4	0.8318
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030891 [exp]	32.2	0.8749

Compare expression of checked genes

Lus10037036 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.