Lus10037038 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003122 74 / 8e-17 AT5G65070 65 / 5e-13 MADS AFFECTING FLOWERING 4, AGAMOUS-like 69, K-box region and MADS-box transcription factor family protein (.1.2.3)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01486 K-box K-box region
Representative CDS sequence
>Lus10037038 pacid=23170995 polypeptide=Lus10037038 locus=Lus10037038.g ID=Lus10037038.BGIv1.0 annot-version=v1.0
ATGAGTGAGAACAGGGCATCTCCTATTGAGCTCAGAGCCTTCACCACATTCGTCTCCACCCCTCTCACTTTGGATGAGGAAGGAGGGGAAATTAGCGAGG
ATGTTGAAGAGGAAGTCAATGATGAAGCTGCAGGAATCTCTCCAACTGCACTACTGCAAATTGTCCAGAGGTACTTTGTTGATCAAGATCCAGCTGACGA
CCAACAGCTGACTGTGGATGAACTTGTACAGTTAGAATACCAACTTGGCATGGCACTAACTCAGATAAGAGCCAGGAAGACGCAACTGGAGTTGGAAACC
TTAAAGACACTCCAGGAAAAGGAACTGGAGCTAAAACGGGAAAATGAGGCCCTGAAGGAACAGATTGCAGCAGCCGTGGATGGTGATGATGATAGCAACA
CAGCTATAGGAACCATTAGAGGCTCTGATAGTTATTTGGGTGGACCTCCAACTCTACGGCTACTTCAATAG
AA sequence
>Lus10037038 pacid=23170995 polypeptide=Lus10037038 locus=Lus10037038.g ID=Lus10037038.BGIv1.0 annot-version=v1.0
MSENRASPIELRAFTTFVSTPLTLDEEGGEISEDVEEEVNDEAAGISPTALLQIVQRYFVDQDPADDQQLTVDELVQLEYQLGMALTQIRARKTQLELET
LKTLQEKELELKRENEALKEQIAAAVDGDDDSNTAIGTIRGSDSYLGGPPTLRLLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65060 MADS FCL3, MAF3, AGL... MADS AFFECTING FLOWERING 3, AG... Lus10037038 0 1
Lus10013609 1.0 0.7976
AT3G61040 CYP76C7 "cytochrome P450, family 76, s... Lus10027425 3.2 0.6583
AT1G52240 PIRF1, ATROPGEF... phytochrome interacting RopGEF... Lus10025794 5.3 0.7340
AT5G65020 ANNAT2 annexin 2 (.1.2) Lus10041696 5.5 0.6932
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10012912 29.8 0.7086
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10012675 36.4 0.6899
AT2G24430 NAC ANAC039, ANAC03... Arabidopsis NAC domain contain... Lus10020165 36.6 0.6830
AT3G02570 PMI1, MEE31 PHOSPHOMANNOSE ISOMERASE 1, MA... Lus10017603 41.7 0.6475
AT3G07800 Thymidine kinase (.1) Lus10006394 65.2 0.6381
AT3G28345 MDR13, ABCB15 multi-drug resistance 13, ATP-... Lus10012959 90.5 0.6310

Lus10037038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.