Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015764 [exp] 109 / 4e-30 AT5G50670 160 / 2e-45 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13B, SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Lus10011348 [exp] 57 / 6e-11 AT5G50670 164 / 3e-48 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13B, SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Lus10003126 [exp] 48 / 8e-08 AT5G50670 161 / 5e-47 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13B, SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G169400 [exp] 50 / 7e-09 AT5G50570 163 / 2e-47 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1), Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.2) Potri.001G058600 [exp] 47 / 1e-07 AT5G50570 164 / 3e-47 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1), Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.2) Potri.015G098900 [exp] 47 / 2e-07 AT5G50570 233 / 1e-73 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1), Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.2) Potri.011G055900 [exp] 39 / 4e-05 AT2G33810 129 / 2e-39 squamosa promoter binding protein-like 3 (.1) Potri.018G149900 [exp] 39 / 6e-05 AT5G43270 187 / 1e-54 squamosa promoter binding protein-like 2 (.1.2.3) Potri.012G100700 [exp] 37 / 0.0003 AT5G50570 222 / 6e-70 SQUAMOSA PROMOTER-BINDING PROTEIN LIKE 13, Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1), Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.2) Potri.004G046700 [exp] 37 / 0.0004 AT1G53160 135 / 4e-41 squamosa promoter binding protein-like 4 (.1.2) Potri.005G258700 [exp] 36 / 0.001 AT1G20980 966 / 0.0 squamosa promoter binding protein-like 14 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037041 pacid=23170993 polypeptide=Lus10037041 locus=Lus10037041.g ID=Lus10037041.BGIv1.0 annot-version=v1.0 ATGCAGACTATCATCGACGGCATAAGGTGTGCGAGCTCCATTCCAAAACTGCCAGAGTTTTCATTAAAGGCCGGGAACAAAGATTATGCCAGCAGTGTAG CAGGTTCCACTCATTGGGAGAGTTCGATGAAGGAAAGCGGAGCTGTAGAAAACGTCTTGATGGGCACAAACGAAGAAGGAGAAAGCCTCACAGCACCCAG ATCCTCTGTCTCTGAGTTCTGCCAGGCTATTCTCTGA
AA sequence Show only first row Show all	>Lus10037041 pacid=23170993 polypeptide=Lus10037041 locus=Lus10037041.g ID=Lus10037041.BGIv1.0 annot-version=v1.0 MQTIIDGIRCASSIPKLPEFSLKAGNKDYASSVAGSTHWESSMKESGAVENVLMGTNEEGESLTAPRSSVSEFCQAIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037041 [exp]	0	1
AT1G05510			Protein of unknown function (D...		Lus10021483 [exp]	1.7	0.8877
					Lus10032770 [exp]	12.1	0.9319
					Lus10004293 [exp]	21.8	0.8955
AT2G25760			Protein kinase family protein ...		Lus10038275 [exp]	22.4	0.7927
AT1G65090			unknown protein		Lus10020377 [exp]	34.4	0.8847
AT5G05490		SYN1 BP5, SYN1 ...	SYNAPTIC 1, DETERMINATE, INFER...		Lus10022711 [exp]	35.7	0.7920
AT5G16023		RTFL18, DVL1	DEVIL 1, ROTUNDIFOLIA like 18 ...		Lus10003079 [exp]	37.6	0.8832
AT2G48030			DNAse I-like superfamily prote...		Lus10027979 [exp]	42.5	0.8758
					Lus10004148 [exp]	76.5	0.8298
AT1G07540	MYB	TRFL2	TRF-like 2 (.1)		Lus10040795 [exp]	89.8	0.7794

Compare expression of checked genes

Lus10037041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.