Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27010 144 / 1e-43 TCP ATTCP20, PCF1, AT-TCP20 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) AT1G69690 130 / 2e-38 TCP AtTCP15, TCP15 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) AT2G45680 129 / 2e-37 TCP TCP9 TCP family transcription factor (.1) AT3G47620 130 / 4e-37 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) AT1G58100 126 / 3e-36 TCP TCP8 TCP domain protein 8, TCP family transcription factor (.1.2) AT5G23280 122 / 7e-36 TCP TCP7 TCP family transcription factor (.1) AT1G72010 125 / 9e-36 TCP TCP22 TCP family transcription factor (.1) AT5G08330 121 / 1e-35 TCP AtTCP11, CHE, TCP21 TCP domain protein 11, TCP family transcription factor (.1) AT5G51910 122 / 3e-35 TCP TCP19 TCP family transcription factor (.1.2) AT1G35560 120 / 4e-34 TCP TCP23 TCP family transcription factor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015760 [exp] 182 / 2e-59 AT3G27010 181 / 1e-55 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10032022 [exp] 149 / 2e-45 AT3G27010 234 / 2e-75 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10037190 [exp] 125 / 2e-35 AT1G69690 172 / 9e-50 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) Lus10010177 [exp] 119 / 5e-34 AT5G23280 186 / 1e-57 TCP family transcription factor (.1) Lus10035193 [exp] 103 / 4e-29 AT3G27010 156 / 6e-47 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10013814 [exp] 101 / 6e-28 AT3G47620 119 / 2e-32 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10041328 [exp] 97 / 6e-26 AT3G47620 93 / 3e-22 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10008621 [exp] 97 / 8e-26 AT3G47620 140 / 4e-38 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10008444 [exp] 71 / 2e-17 AT1G58100 104 / 5e-28 TCP domain protein 8, TCP family transcription factor (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G060000 [exp] 151 / 2e-46 AT3G27010 215 / 2e-68 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.017G068748 [exp] 140 / 2e-42 AT3G27010 231 / 3e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.001G327100 [exp] 140 / 3e-42 AT3G27010 230 / 6e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.003G167900 [exp] 134 / 6e-40 AT3G27010 212 / 3e-67 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.011G055500 [exp] 132 / 1e-38 AT3G47620 173 / 2e-49 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.004G046300 [exp] 131 / 4e-38 AT3G47620 182 / 2e-52 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.014G078500 [exp] 129 / 1e-37 AT2G45680 257 / 1e-83 TCP family transcription factor (.1) Potri.002G152200 [exp] 124 / 1e-35 AT2G45680 286 / 6e-95 TCP family transcription factor (.1) Potri.019G081800 [exp] 125 / 2e-35 AT1G72010 220 / 5e-68 TCP family transcription factor (.1) Potri.013G110700 [exp] 124 / 2e-35 AT1G35560 224 / 9e-70 TCP family transcription factor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03634 [flax] [poplar] TCP TCP family transcription factor
Representative CDS sequence Show only first row Show all	>Lus10037046 pacid=23171321 polypeptide=Lus10037046 locus=Lus10037046.g ID=Lus10037046.BGIv1.0 annot-version=v1.0 ATGAAAGACGTTCAAATCACAGCACTTGTTCCAACCAGCAGTACAAAGAAGCAGCAGAGTTTAGGTCCGAGGAGGAGTTCGAACAAGGACAGGCACAAGA AAGTTGACGGAAGAGGGAGAAGGATCAGGATGCCGGCTTTATGCGCCGCTAGGATCTTCCAGCTAACTCGAGAATTGGGTCACAAATCCGACGGCGAGAC CATCCAGTGGCTTCTGAACCAATCTGAGCCGTCCATCATTGCAGCCACTGGAACCGGAACCATTCCGGCCTCTGCCCTTGCCGCTGCTAGGTCCTCTGGA TGGATTTCCCGAATATAA
AA sequence Show only first row Show all	>Lus10037046 pacid=23171321 polypeptide=Lus10037046 locus=Lus10037046.g ID=Lus10037046.BGIv1.0 annot-version=v1.0 MKDVQITALVPTSSTKKQQSLGPRRSSNKDRHKKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLNQSEPSIIAATGTGTIPASALAAARSSG WISRI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Lus10037046 [exp]	0	1
AT3G07310			Protein of unknown function (D...		Lus10038208 [exp]	2.8	0.8511
AT2G15230		ATLIP1	lipase 1 (.1)		Lus10002809 [exp]	4.9	0.8037
AT4G31040			CemA-like proton extrusion pro...		Lus10040575 [exp]	6.8	0.8338
AT1G27290			unknown protein		Lus10037037 [exp]	7.3	0.7839
AT2G15890		MEE14	maternal effect embryo arrest ...		Lus10012044 [exp]	8.7	0.8071
AT3G57170			N-acetylglucosaminyl transfera...		Lus10003248 [exp]	14.8	0.7838
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Lus10004268 [exp]	16.5	0.7664
AT3G06350		EMB3004, MEE32	MATERNAL EFFECT EMBRYO ARREST ...		Lus10004130 [exp]	17.7	0.7822
AT4G31040			CemA-like proton extrusion pro...		Lus10021616 [exp]	18.2	0.8032
AT5G51020		CAA33, CRL	constitutive activator of AAA-...		Lus10043210 [exp]	19.0	0.7712

Compare expression of checked genes

Lus10037046 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.