Lus10037049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13160 260 / 5e-86 PBS1 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
AT5G18610 239 / 7e-77 Protein kinase superfamily protein (.1.2)
AT3G07070 192 / 7e-60 Protein kinase superfamily protein (.1)
AT5G02800 189 / 4e-59 CDL1 CDG1-like 1, Protein kinase superfamily protein (.1)
AT3G24790 188 / 7e-59 Protein kinase superfamily protein (.1)
AT4G13190 180 / 2e-55 Protein kinase superfamily protein (.1)
AT1G20650 179 / 2e-55 ASG5 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
AT3G20530 179 / 3e-55 Protein kinase superfamily protein (.1)
AT1G07870 172 / 3e-52 Protein kinase superfamily protein (.1.2)
AT1G76370 171 / 5e-52 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015756 353 / 3e-122 AT5G13160 732 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Lus10033966 238 / 1e-76 AT5G18610 805 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10012814 233 / 1e-74 AT5G18610 807 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10036499 207 / 7e-66 AT5G18610 575 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10041426 206 / 2e-65 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10023473 194 / 8e-61 AT5G18610 568 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10040350 191 / 2e-59 AT5G18610 569 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10019897 188 / 1e-58 AT5G02800 533 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1)
Lus10011866 188 / 4e-58 AT3G07070 556 / 0.0 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G060800 296 / 9e-100 AT5G13160 714 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.003G166900 290 / 3e-97 AT5G13160 745 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.010G021500 238 / 8e-77 AT5G18610 779 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.008G205700 238 / 9e-77 AT5G18610 783 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.010G215100 212 / 3e-68 AT5G18610 595 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.008G046500 202 / 4e-64 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.002G241600 199 / 2e-62 AT3G07070 543 / 0.0 Protein kinase superfamily protein (.1)
Potri.006G133300 194 / 1e-60 AT5G02800 566 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1)
Potri.001G421400 188 / 1e-58 AT3G20530 587 / 0.0 Protein kinase superfamily protein (.1)
Potri.011G137000 179 / 5e-55 AT3G20530 555 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10037049 pacid=23171008 polypeptide=Lus10037049 locus=Lus10037049.g ID=Lus10037049.BGIv1.0 annot-version=v1.0
ATGGGTTGTTTCCCTTGTTTCGATTCCAGGGAAGAGGAGACCTTGAATCGAGATGAGAAGTCCGATGATCGGAAACCAACTTCCTTGCCCACTGCCGCCT
CCAATATTTCCAAATTGTCTTCTGGATCTGAAAGGCTGAGAGCAAGAAGCCTTGGACTGTCCAAAAGGGAATTAACATCTCCCAAGGATGCACCCGCTGG
CAATATTGCAGCTCAAACATTTACTTTCCGTGAGCTTGCAGCCGCAACTAAGAATTTTAGGCCTGAGTCTTTCTTAGGGGAAGGAGGATTCGGGCGTGTA
TATAAAGGACGGCTTGAGAGTACTGGTCAGGTTGTTGCTGTGAAGCAATTAGATAGAAATGGGCTACAGGGTAATAGAGAATTTCTGGTGGAGGTTCTCA
TGCTTAGCCTTTTACATCATCCGAATCTTGTGAGCCTTATTGGCTATTGTGCTGATGGTGATCAGCGGCTGCTTGTCTATGAGTTCATGCCGTTCGGATC
TCTGGAAGATCATCTTCATGGTAACCACTTCAATCTGGAATTTATTTTAGAATTTACACTCATGACAATCAACTAG
AA sequence
>Lus10037049 pacid=23171008 polypeptide=Lus10037049 locus=Lus10037049.g ID=Lus10037049.BGIv1.0 annot-version=v1.0
MGCFPCFDSREEETLNRDEKSDDRKPTSLPTAASNISKLSSGSERLRARSLGLSKRELTSPKDAPAGNIAAQTFTFRELAAATKNFRPESFLGEGGFGRV
YKGRLESTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVSLIGYCADGDQRLLVYEFMPFGSLEDHLHGNHFNLEFILEFTLMTIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13160 PBS1 avrPphB susceptible 1, Protein... Lus10037049 0 1
AT1G18260 HRD3A, EBS5 EMS-mutagenized bri1 suppresso... Lus10009042 5.2 0.8284
AT3G02740 Eukaryotic aspartyl protease f... Lus10041103 8.5 0.7986
AT4G08180 ORP1C OSBP(oxysterol binding protein... Lus10028087 11.3 0.7926
AT3G06720 IMPA1, IMPA-1, ... importin alpha isoform 1 (.1.2... Lus10010933 11.6 0.8130
AT2G43160 ENTH/VHS family protein (.1.2.... Lus10026741 12.2 0.8050
AT5G46630 Clathrin adaptor complexes med... Lus10030961 15.2 0.7950
AT1G59610 DRP2B, CF1, ADL... Dynamin related protein 2B, dy... Lus10007887 15.4 0.8213
AT2G40730 CTEXP cytoplasmic tRNA export protei... Lus10029025 18.2 0.7769
AT3G63460 EMB2221 transducin family protein / WD... Lus10019752 22.7 0.8029
AT2G17790 ZIP3, VPS35A ZIG suppressor 3, VPS35 homolo... Lus10041880 23.2 0.7653

Lus10037049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.