Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036923 [exp] 55 / 4e-12 AT1G24405 61 / 2e-14 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037061 pacid=23152555 polypeptide=Lus10037061 locus=Lus10037061.g ID=Lus10037061.BGIv1.0 annot-version=v1.0 ATGGATAATGGGTTATCATGGGCAGATCAATGGGATTACAACAATGATCCTCCTCCACACAACAACTCAAATGACAAGAAGAAGGGCAAAGATGGGAGCA AGAGCAGCATTCGCAAGAAGTTTCTGAGCTTGAAATGGATGAAAGATCTCAGGAAGAAGCCATCCAAGGAGGGGGAATGA
AA sequence Show only first row Show all	>Lus10037061 pacid=23152555 polypeptide=Lus10037061 locus=Lus10037061.g ID=Lus10037061.BGIv1.0 annot-version=v1.0 MDNGLSWADQWDYNNDPPPHNNSNDKKKGKDGSKSSIRKKFLSLKWMKDLRKKPSKEGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24405			unknown protein		Lus10037061 [exp]	0	1
AT1G24405			unknown protein		Lus10036923 [exp]	1.0	0.9892
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10022471 [exp]	3.2	0.9655
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10016775 [exp]	4.5	0.9591
AT4G20820			FAD-binding Berberine family p...		Lus10038436 [exp]	4.7	0.9472
					Lus10033897 [exp]	4.9	0.9544
AT1G67030	C2H2ZnF	ZFP6	zinc finger protein 6 (.1)		Lus10017609 [exp]	5.2	0.9517
AT1G49960			Xanthine/uracil permease famil...		Lus10033773 [exp]	5.3	0.9609
AT4G24130			Protein of unknown function, D...		Lus10017330 [exp]	6.0	0.9621
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10013480 [exp]	7.7	0.9280
					Lus10034812 [exp]	9.8	0.9525

Compare expression of checked genes

Lus10037061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.