Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37170 124 / 2e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G02750 119 / 1e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G08070 112 / 2e-30 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G09040 112 / 4e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G23330 111 / 7e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G26782 111 / 7e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G13600 110 / 2e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18750 107 / 2e-28 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G20230 107 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G25360 107 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036921 [exp] 210 / 8e-66 AT4G37170 806 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030225 [exp] 120 / 3e-34 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005987 [exp] 122 / 5e-34 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10001617 [exp] 113 / 2e-30 AT2G03880 840 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10024936 [exp] 113 / 2e-30 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10006815 [exp] 105 / 2e-30 AT1G20230 116 / 6e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009269 [exp] 112 / 5e-30 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015898 [exp] 111 / 7e-30 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10016425 [exp] 111 / 1e-29 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G091600 [exp] 160 / 3e-47 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G040100 [exp] 120 / 5e-33 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G027800 [exp] 119 / 2e-32 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G175900 [exp] 113 / 8e-31 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G048800 [exp] 114 / 1e-30 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G041200 [exp] 112 / 2e-30 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G322100 [exp] 111 / 9e-30 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G059400 [exp] 111 / 1e-29 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G085500 [exp] 110 / 1e-29 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.013G058900 [exp] 110 / 2e-29 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037063 pacid=23152361 polypeptide=Lus10037063 locus=Lus10037063.g ID=Lus10037063.BGIv1.0 annot-version=v1.0 ATGAAGAACATGAAGCCTGACAAGTACATTTGGGCTTCCTTGCTTGGAGGTTGCAGAATCCATAAGAACGTCGAACTTGCTGAGAAGTCTGCAGAAGCAT TGTTCGAGATCGAACCAGGGAATCCAGCTGCTTATGTGACAATGGCGAATATATACGCCACTTCTGGGAGATGGTCCGAGGTGGCCAAGATCAGAAAGCT TATGGATGGGAGAGGAGTGGCGACGAAGAAACCGTGTAAGAGTTGGATTGAGATCAAGAGAAAGACGCATTCTTTTTGTGTTGGGGACAAATCCCACCCG GAATCGAAACGAATATACTAG
AA sequence Show only first row Show all	>Lus10037063 pacid=23152361 polypeptide=Lus10037063 locus=Lus10037063.g ID=Lus10037063.BGIv1.0 annot-version=v1.0 MKNMKPDKYIWASLLGGCRIHKNVELAEKSAEALFEIEPGNPAAYVTMANIYATSGRWSEVAKIRKLMDGRGVATKKPCKSWIEIKRKTHSFCVGDKSHP ESKRIY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37170			Pentatricopeptide repeat (PPR)...		Lus10037063 [exp]	0	1
AT1G67970	HSF	AT-HSFA8	heat shock transcription facto...		Lus10001591 [exp]	13.1	0.6779
AT3G19553			Amino acid permease family pro...		Lus10040966 [exp]	33.0	0.6695
AT1G66340		AtETR1, EIN1, E...	ETHYLENE RESPONSE 1, ETHYLENE ...		Lus10020778 [exp]	34.8	0.6587
AT5G57710			Double Clp-N motif-containing ...		Lus10015511 [exp]	53.2	0.6058
AT1G02290			unknown protein		Lus10028606 [exp]	56.9	0.6302
AT4G03000			RING/U-box superfamily protein...		Lus10021953 [exp]	60.3	0.6235
AT3G05675			BTB/POZ domain-containing prot...		Lus10023030 [exp]	100.8	0.5555
AT5G41620			unknown protein		Lus10003027 [exp]	127.6	0.5751
AT4G16835			Tetratricopeptide repeat (TPR)...		Lus10000597 [exp]	245.7	0.5131

Compare expression of checked genes

Lus10037063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.