Lus10037099 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26560 149 / 7e-44 BGLU40 beta glucosidase 40 (.1)
AT5G54570 121 / 2e-33 BGLU41 beta glucosidase 41 (.1)
AT2G44470 105 / 3e-27 BGLU29 beta glucosidase 29 (.1.2.3)
AT5G24550 104 / 3e-27 BGLU32 beta glucosidase 32 (.1)
AT5G36890 102 / 2e-26 BGLU42 beta glucosidase 42 (.1.2)
AT3G60140 102 / 2e-26 BGLU30, SRG2, DIN2 SENESCENCE-RELATED GENE 2, DARK INDUCIBLE 2, BETA GLUCOSIDASE 30, Glycosyl hydrolase superfamily protein (.1)
AT5G24540 102 / 3e-26 BGLU31 beta glucosidase 31 (.1)
AT2G44490 99 / 5e-25 BGLU26, PEN2 PENETRATION 2, BETA GLUCOSIDASE 26, Glycosyl hydrolase superfamily protein (.1)
AT1G61820 97 / 7e-25 BGLU46 beta glucosidase 46 (.1.3)
AT3G18080 97 / 2e-24 BGLU44 B-S glucosidase 44 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037098 197 / 7e-62 AT1G26560 785 / 0.0 beta glucosidase 40 (.1)
Lus10036885 191 / 1e-59 AT1G26560 778 / 0.0 beta glucosidase 40 (.1)
Lus10004654 165 / 1e-49 AT1G26560 773 / 0.0 beta glucosidase 40 (.1)
Lus10037987 135 / 8e-38 AT5G54570 662 / 0.0 beta glucosidase 41 (.1)
Lus10009218 133 / 5e-37 AT5G04240 993 / 0.0 EARLY FLOWERING 6, Zinc finger (C2H2 type) family protein / transcription factor jumonji (jmj) family protein (.1)
Lus10037988 132 / 5e-37 AT5G54570 741 / 0.0 beta glucosidase 41 (.1)
Lus10020234 94 / 4e-25 AT5G36890 217 / 2e-69 beta glucosidase 42 (.1.2)
Lus10019531 99 / 5e-25 AT2G44480 597 / 0.0 beta glucosidase 17 (.1.2)
Lus10031808 97 / 2e-24 AT2G44480 560 / 0.0 beta glucosidase 17 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G094200 155 / 4e-46 AT1G26560 798 / 0.0 beta glucosidase 40 (.1)
Potri.010G159900 150 / 4e-44 AT1G26560 795 / 0.0 beta glucosidase 40 (.1)
Potri.001G409900 120 / 8e-33 AT5G54570 791 / 0.0 beta glucosidase 41 (.1)
Potri.004G109699 102 / 7e-27 AT5G44640 288 / 5e-94 beta glucosidase 13 (.1)
Potri.004G109166 102 / 3e-26 AT5G42260 525 / 0.0 beta glucosidase 12 (.1)
Potri.004G110620 102 / 3e-26 AT5G42260 525 / 0.0 beta glucosidase 12 (.1)
Potri.004G110691 102 / 3e-26 AT2G44480 524 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G222900 102 / 3e-26 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G223300 102 / 3e-26 AT2G44480 529 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G222904 102 / 3e-26 AT2G44480 531 / 0.0 beta glucosidase 17 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence
>Lus10037099 pacid=23152470 polypeptide=Lus10037099 locus=Lus10037099.g ID=Lus10037099.BGIv1.0 annot-version=v1.0
ATGAGGTTTTGTTGTGCGAAACAAGTATCATTGATTTTGGGTTGCTGTTTGGGGCATCTACAGGAGGCTTTATTGTGCGAGAGATCATCCAACTGTATGG
ATAACCCGCATAGCCCATTCATCTCGATCAAAGATGCACAAAAGGACGAGAAAAGGATCAGATACCTCAATGGTTACCTTACAAACTTGCTAGCTTCCAT
CAAGGAAGATGGGTGCAATGTGAAAGGGTACTTTGTGTGGTCATTGCTAGACAATTGGGAATGGTCAGCTGGATACACTTCAAGATTTGGTCTCTACTAT
GTTGATTTCAAGGATAATCTCAAGAGATACCCTAAGAACTCTGTTACTTGGCTCACAAACTTCTTGACCCCTTCTGCTTAA
AA sequence
>Lus10037099 pacid=23152470 polypeptide=Lus10037099 locus=Lus10037099.g ID=Lus10037099.BGIv1.0 annot-version=v1.0
MRFCCAKQVSLILGCCLGHLQEALLCERSSNCMDNPHSPFISIKDAQKDEKRIRYLNGYLTNLLASIKEDGCNVKGYFVWSLLDNWEWSAGYTSRFGLYY
VDFKDNLKRYPKNSVTWLTNFLTPSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26560 BGLU40 beta glucosidase 40 (.1) Lus10037099 0 1
AT2G23180 CYP96A1 "cytochrome P450, family 96, s... Lus10003756 1.0 0.9724
AT1G27170 transmembrane receptors;ATP bi... Lus10008414 1.4 0.9043
AT2G30300 Major facilitator superfamily ... Lus10015470 2.4 0.8863
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Lus10013753 18.3 0.7620
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10025692 20.4 0.7607
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 22.3 0.7588
Lus10024141 24.1 0.7588
Lus10013255 25.8 0.7588
Lus10013259 27.3 0.7588
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10013964 28.8 0.7588

Lus10037099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.