Lus10037114 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07260 84 / 5e-19 UGT71C3 UDP-glucosyl transferase 71C3 (.1)
AT2G29740 82 / 2e-18 UGT71C2 UDP-glucosyl transferase 71C2 (.1)
AT2G31790 79 / 3e-17 UDP-Glycosyltransferase superfamily protein (.1)
AT1G07240 79 / 4e-17 UGT71C5 UDP-glucosyl transferase 71C5 (.1)
AT4G15280 78 / 9e-17 UGT71B5 UDP-glucosyl transferase 71B5 (.1)
AT3G16520 77 / 2e-16 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3)
AT1G78270 77 / 2e-16 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
AT4G36770 77 / 2e-16 UDP-Glycosyltransferase superfamily protein (.1)
AT1G22400 77 / 2e-16 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
AT1G07250 76 / 4e-16 UGT71C4 UDP-glucosyl transferase 71C4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036967 274 / 7e-91 AT4G01070 172 / 3e-48 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Lus10036969 166 / 5e-48 AT1G78270 190 / 3e-53 UDP-glucosyl transferase 85A4 (.1)
Lus10037117 101 / 2e-25 AT1G78270 143 / 2e-38 UDP-glucosyl transferase 85A4 (.1)
Lus10031819 98 / 8e-24 AT5G12890 506 / 4e-177 UDP-Glycosyltransferase superfamily protein (.1)
Lus10031248 97 / 2e-23 AT5G12890 512 / 2e-179 UDP-Glycosyltransferase superfamily protein (.1)
Lus10019831 94 / 1e-22 AT2G15490 425 / 8e-146 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014084 94 / 1e-22 AT2G15490 445 / 2e-153 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10027542 93 / 4e-22 AT3G16520 431 / 3e-148 UDP-glucosyl transferase 88A1 (.1.2.3)
Lus10026795 89 / 2e-20 AT3G21750 448 / 5e-155 UDP-glucosyl transferase 71B1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G089000 172 / 1e-51 AT3G16520 174 / 3e-49 UDP-glucosyl transferase 88A1 (.1.2.3)
Potri.004G126000 157 / 9e-46 AT3G16520 192 / 9e-56 UDP-glucosyl transferase 88A1 (.1.2.3)
Potri.T010801 83 / 1e-18 AT3G16520 338 / 4e-112 UDP-glucosyl transferase 88A1 (.1.2.3)
Potri.T010800 83 / 1e-18 AT3G16520 343 / 6e-114 UDP-glucosyl transferase 88A1 (.1.2.3)
Potri.001G303000 83 / 2e-18 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.006G048200 82 / 2e-18 AT2G15490 193 / 7e-56 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.016G057300 82 / 2e-18 AT2G15490 184 / 2e-52 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.001G303600 82 / 3e-18 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.009G098966 82 / 5e-18 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.006G007100 81 / 5e-18 AT3G21760 325 / 4e-109 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10037114 pacid=23152499 polypeptide=Lus10037114 locus=Lus10037114.g ID=Lus10037114.BGIv1.0 annot-version=v1.0
ATGGCGTTGAAGTGGTTAGAAGGGAAGCCAGCAAAGTCCGTCGTGTACGTTAGTTTTGGGAACAGGACGACTCTGCCAAGAGACCAAATCAAAGAGTTGG
GGAAAAGATTGATCGGATCAGGAGTTCATTTCATCTGGATGGTGAAGGACAAAGTGGACCAAAAGGACAAAGAGAGGTTGGAAGATGTTTTGGGAGAGGA
GATGATGGAGGAGGTTGGGAAGAGAGGGGTGGTGGTGAAGGAGTGGGTGGATCGGGCTGACATAATTGGACACGAATTTGTGGGGGGATTTTTGAGCTGC
GGGTGGAACTTTGTGGTGGGGTTTGCATGGTGCGGCGTTCCTATGATGGGGTGGCCGCCTAATGGAGATCAGAAGGTGAATGGGGGAGTGGTGGAGAGGT
GTGGGCTAGGGTTTATGGGTGGGGAATGGGGTTGGATGGGAAATTTCTTGGTGAAGGGGGAAGAGATTGGGGAGAGGATTAAGGAGTTGATGGACGATGT
GAAGATGAGGAAGGTTGTTGGGGAGATTAAGGAGCATGTTAGGAAGGATGTTGGTGAAGGTGTGAGTTTGAAACAGCTGGTGAACAAGTTGAGTTCTTGA
AA sequence
>Lus10037114 pacid=23152499 polypeptide=Lus10037114 locus=Lus10037114.g ID=Lus10037114.BGIv1.0 annot-version=v1.0
MALKWLEGKPAKSVVYVSFGNRTTLPRDQIKELGKRLIGSGVHFIWMVKDKVDQKDKERLEDVLGEEMMEEVGKRGVVVKEWVDRADIIGHEFVGGFLSC
GWNFVVGFAWCGVPMMGWPPNGDQKVNGGVVERCGLGFMGGEWGWMGNFLVKGEEIGERIKELMDDVKMRKVVGEIKEHVRKDVGEGVSLKQLVNKLSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07260 UGT71C3 UDP-glucosyl transferase 71C3 ... Lus10037114 0 1
AT5G47810 PFK2 phosphofructokinase 2 (.1) Lus10039993 8.9 0.8193
AT3G17930 unknown protein Lus10042280 9.1 0.8612
Lus10042279 13.0 0.8417
AT5G61280 Remorin family protein (.1) Lus10034714 15.1 0.8168
AT1G08070 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSIN... Lus10030053 15.6 0.8441
AT1G54730 Major facilitator superfamily ... Lus10029964 17.5 0.8380
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10002906 18.6 0.8482
AT2G35210 RPA, AGD10, MEE... MATERNAL EFFECT EMBRYO ARREST ... Lus10000902 20.7 0.7789
AT5G38510 Rhomboid-related intramembrane... Lus10000628 26.7 0.8312
AT5G19500 Tryptophan/tyrosine permease (... Lus10036099 29.5 0.8127

Lus10037114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.