Lus10037149 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036778 149 / 4e-45 ND 39 / 0.003
Lus10037151 84 / 3e-20 AT5G02700 60 / 2e-10 F-box/RNI-like superfamily protein (.1)
Lus10028722 76 / 2e-16 AT2G42730 76 / 1e-14 F-box family protein (.1.2)
Lus10011267 59 / 1e-10 ND 39 / 0.002
Lus10021237 53 / 7e-09 ND /
Lus10028649 51 / 9e-08 AT1G21380 452 / 7e-152 Target of Myb protein 1 (.1)
Lus10032314 48 / 5e-07 ND /
Lus10028610 41 / 8e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10037149 pacid=23152316 polypeptide=Lus10037149 locus=Lus10037149.g ID=Lus10037149.BGIv1.0 annot-version=v1.0
ATGCCTCTTTGCTACGTAAACTCATTGTTGCGGGATCCCCAATTGAAGTACTTGGAAGTAATCAGCTGCCCTCGCCTTTCCTCCATGAAGATTGATAATG
CTCCTAGCCTTATCCGGGTTGTTTATCGTGGTCTATGGGCCGGTGTGAGTTTCGAGAACTGTCCATCTCTTGTGGATGTGGACGTATCTTATGGGCACGA
GTCGTCTGAATTTGCATTTGATTCCCTTTCCCCTTACGCTGGTCAGCTCGACTCTCTTTCGTTGGCGATAGACCCTTCGAACATGTTCTTTCCTGAAATG
GTTATGGATGAATTCAGCTCACTTGAGCAACTGAAGATCAAAGTAGTTGGTGCAATATCTGATGATGCCATACTTCGATTAATTCCATTATTACACGCTT
GTCCTCGGTTGCATACACTAAGAGTGGAGGTGAATGTGGAGTACAATCCGGACGGGGTGTGCGTATGA
AA sequence
>Lus10037149 pacid=23152316 polypeptide=Lus10037149 locus=Lus10037149.g ID=Lus10037149.BGIv1.0 annot-version=v1.0
MPLCYVNSLLRDPQLKYLEVISCPRLSSMKIDNAPSLIRVVYRGLWAGVSFENCPSLVDVDVSYGHESSEFAFDSLSPYAGQLDSLSLAIDPSNMFFPEM
VMDEFSSLEQLKIKVVGAISDDAILRLIPLLHACPRLHTLRVEVNVEYNPDGVCV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10037149 0 1
AT5G22450 unknown protein Lus10000530 4.6 1.0000
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 6.5 1.0000
Lus10011425 9.0 1.0000
AT3G02100 UDP-Glycosyltransferase superf... Lus10015750 9.2 1.0000
AT4G13090 XTH2 xyloglucan endotransglucosylas... Lus10032879 11.2 1.0000
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10031524 11.6 1.0000
Lus10007184 12.1 1.0000
Lus10007226 13.0 1.0000
AT2G28605 Photosystem II reaction center... Lus10009159 13.7 1.0000
AT4G05120 FUR1, ENT3, FLU... FUDR RESISTANT 1, EQUILIBRATIV... Lus10018414 15.2 1.0000

Lus10037149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.