Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18720 92 / 2e-24 Protein of unknown function (DUF962) (.1) AT1G74440 89 / 5e-23 Protein of unknown function (DUF962) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036771 [exp] 170 / 6e-55 AT1G18720 250 / 3e-85 Protein of unknown function (DUF962) (.1) Lus10030447 [exp] 140 / 4e-43 AT1G18720 256 / 2e-87 Protein of unknown function (DUF962) (.1) Lus10001646 [exp] 88 / 1e-22 AT1G18720 246 / 3e-83 Protein of unknown function (DUF962) (.1) Lus10021661 [exp] 86 / 8e-22 AT1G18720 242 / 8e-82 Protein of unknown function (DUF962) (.1) Lus10021660 [exp] 72 / 2e-16 AT1G18720 174 / 3e-55 Protein of unknown function (DUF962) (.1) Lus10001647 [exp] 44 / 1e-06 AT1G18720 62 / 7e-13 Protein of unknown function (DUF962) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G088800 [exp] 126 / 9e-38 AT1G18720 245 / 4e-83 Protein of unknown function (DUF962) (.1) Potri.010G166500 [exp] 106 / 7e-30 AT1G18720 251 / 2e-85 Protein of unknown function (DUF962) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06127 [flax] [poplar] DUF962 Protein of unknown function (DUF962)
Representative CDS sequence Show only first row Show all	>Lus10037158 pacid=23152551 polypeptide=Lus10037158 locus=Lus10037158.g ID=Lus10037158.BGIv1.0 annot-version=v1.0 ATGGCGAGGTTGTCCTTCTTTGATCTAGAGCGACACTTCGCCTTCTACGGAGCATACCACAGCAACCCAACCAACAAAGCTGGTTCCTTGGCTGCATTGA TCTTGGTCTTCTGTCTTTTCGCCAGTAGCTTCCTGGGTGCTTGCCTTGGTTTCTCACTTGCTTGGAAGGTGGTTGTGGTTGCTCAGATTGTATGTTGGAC TGGACAGTTCATTGGACATGGGGTGTTTGAGGCTCTACAAACCTTCTTCGGTTATGAACCGTACTCTGGATTTCACGAAACTGTGCAAGCTAAGGTCGAT GCTGAGATCCGTGAATGGCAAGAGGAGAAGAAAAAGAAGTAA
AA sequence Show only first row Show all	>Lus10037158 pacid=23152551 polypeptide=Lus10037158 locus=Lus10037158.g ID=Lus10037158.BGIv1.0 annot-version=v1.0 MARLSFFDLERHFAFYGAYHSNPTNKAGSLAALILVFCLFASSFLGACLGFSLAWKVVVVAQIVCWTGQFIGHGVFEALQTFFGYEPYSGFHETVQAKVD AEIREWQEEKKKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G18720			Protein of unknown function (D...		Lus10037158 [exp]	0	1
AT5G60410		ATSIZ1, SIZ1	DNA-binding protein with MIZ/S...		Lus10011634 [exp]	11.0	0.8510
AT1G63900		DAL1	DIAP1-like protein 1, E3 Ubiqu...		Lus10027994 [exp]	11.9	0.8487
AT2G26280		CID7	CTC-interacting domain 7 (.1)		Lus10009796 [exp]	17.0	0.8312
AT1G07480			Transcription factor IIA, alph...		Lus10001563 [exp]	17.1	0.8250
AT5G47860			Protein of unknown function (D...		Lus10008591 [exp]	18.3	0.8427
AT4G24470	GATA	GATA25, TIFY1, ...	Zinc-finger protein expressed ...		Lus10028166 [exp]	25.0	0.8133
AT2G39630			Nucleotide-diphospho-sugar tra...		Lus10005164 [exp]	26.9	0.8374
AT5G53350		CLPX	CLP protease regulatory subuni...		Lus10036701 [exp]	32.3	0.8275
AT3G45630			RNA binding (RRM/RBD/RNP motif...		Lus10018126 [exp]	32.5	0.8165
AT1G78070			Transducin/WD40 repeat-like su...		Lus10041102 [exp]	41.4	0.8214

Compare expression of checked genes

Lus10037158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.