Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69588 40 / 4e-05 CLE45 CLAVATA3/ESR-RELATED 45 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002061 [exp] 58 / 2e-12 ND 37 / 5e-04 Lus10024213 [exp] 57 / 4e-12 ND 40 / 3e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G169300 [exp] 76 / 3e-19 AT1G69588 57 / 1e-11 CLAVATA3/ESR-RELATED 45 (.1) Potri.008G086100 [exp] 63 / 2e-14 AT1G69588 52 / 7e-10 CLAVATA3/ESR-RELATED 45 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037173 pacid=23152479 polypeptide=Lus10037173 locus=Lus10037173.g ID=Lus10037173.BGIv1.0 annot-version=v1.0 ATGATGTTTGTGGGAAGTTCAAGATTGCTAGGCTTCATTCTATGCATAGGGCTAATCACAATTCAGCAGCATCATCATGTTGTTCATGGGTTAGCAAGCA AAGACATCATCTTCATGGGAAGTGATCAAGTAGTCCAACACCAAGCCAGATTTCTCAAGGATGTTACAATGAGTACCAAGAATAAGAAGAAGCAACTTTC GTCGACAGGATCGAACAAGGGTTTCGACCCGAATCAATCGAGCAAGCGGAGATTTCGAAGAGGGTCGGATCCTATCCACAATAGGTCACTATGA
AA sequence Show only first row Show all	>Lus10037173 pacid=23152479 polypeptide=Lus10037173 locus=Lus10037173.g ID=Lus10037173.BGIv1.0 annot-version=v1.0 MMFVGSSRLLGFILCIGLITIQQHHHVVHGLASKDIIFMGSDQVVQHQARFLKDVTMSTKNKKKQLSSTGSNKGFDPNQSSKRRFRRGSDPIHNRSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037173 [exp]	0	1
AT1G76770			HSP20-like chaperones superfam...		Lus10028577 [exp]	3.2	0.9641
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	3.5	0.9695
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Lus10000180 [exp]	4.5	0.9666
AT2G20362			unknown protein		Lus10024963 [exp]	4.6	0.9585
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10009316 [exp]	5.7	0.9647
AT4G37445			unknown protein		Lus10001408 [exp]	6.6	0.9645
AT1G27180			disease resistance protein (TI...		Lus10007831 [exp]	6.9	0.9583
AT5G36930			Disease resistance protein (TI...		Lus10007852 [exp]	8.8	0.9620
					Lus10035158 [exp]	9.0	0.9379
AT5G04890		RTM2	RESTRICTED TEV MOVEMENT 2, HSP...		Lus10023624 [exp]	11.0	0.9416

Compare expression of checked genes

Lus10037173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.