Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26880 182 / 6e-61 Ribosomal protein L34e superfamily protein (.1.2) AT1G69620 179 / 6e-60 RPL34 ribosomal protein L34 (.1) AT3G28900 177 / 9e-59 Ribosomal protein L34e superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042199 [exp] 191 / 2e-64 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10012829 [exp] 191 / 3e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10030477 [exp] 191 / 3e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10036750 [exp] 189 / 9e-64 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10008617 [exp] 188 / 4e-63 AT1G26880 215 / 8e-74 Ribosomal protein L34e superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G082200 [exp] 186 / 2e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108400 [exp] 186 / 2e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106466 [exp] 186 / 3e-62 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106532 [exp] 186 / 3e-62 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.001G195101 [exp] 177 / 5e-59 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2) Potri.004G029400 [exp] 164 / 1e-53 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108301 [exp] 107 / 1e-31 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01199 [flax] [poplar] Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence Show only first row Show all	>Lus10037177 pacid=23152244 polypeptide=Lus10037177 locus=Lus10037177.g ID=Lus10037177.BGIv1.0 annot-version=v1.0 ATGGTTCAGCGGTTAACTTACCGTAAGCGCCATAGCTACGCCACAAAGTCCAACCAGCACCGGATTGTCAAAACTCCTGGTGGGAAGTTGGTGTATCAGA CCACCAAGAAGAGGGCCAGCGGACCGAAATGCCCTGTTACTGGGAAGAGGATTCAAGGGATTCCGCACTTGAGACCTGCTGAGTACAAGAGGTCAAGATT GCCAAGGAACAGGAGGACTGTGAACCGTGCCTATGGAGGAGTTCTTTCTGGAGGTGCTGTCAGAGAAAGGATCATCCGTGCTTTCCTGGTCGAAGAGCAA AAGATTGTGAAGAAGGTCTTGAAGATCCAAAAATCCAAGGAAAAGGTCACCAAGAGCTAA
AA sequence Show only first row Show all	>Lus10037177 pacid=23152244 polypeptide=Lus10037177 locus=Lus10037177.g ID=Lus10037177.BGIv1.0 annot-version=v1.0 MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQ KIVKKVLKIQKSKEKVTKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26880			Ribosomal protein L34e superfa...		Lus10037177 [exp]	0	1
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031979 [exp]	1.4	0.9678
AT5G12110			Glutathione S-transferase, C-t...		Lus10036101 [exp]	2.2	0.9563
AT5G57290			60S acidic ribosomal protein f...		Lus10012714 [exp]	2.4	0.9549
AT4G29410			Ribosomal L28e protein family ...		Lus10032699 [exp]	2.4	0.9646
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Lus10023733 [exp]	3.9	0.9378
AT5G59850			Ribosomal protein S8 family pr...		Lus10029461 [exp]	4.6	0.9519
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10035650 [exp]	4.9	0.9568
AT5G15200			Ribosomal protein S4 (.1.2)		Lus10030487 [exp]	5.1	0.9399
AT4G18100			Ribosomal protein L32e (.1)		Lus10009591 [exp]	5.7	0.9569
AT3G13940			DNA binding;DNA-directed RNA p...		Lus10020738 [exp]	6.2	0.9189

Compare expression of checked genes

Lus10037177 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.