Lus10037193 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26900 202 / 2e-62 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G15130 160 / 5e-46 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G02980 157 / 3e-45 OTP85 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G66520 154 / 3e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G14820 150 / 1e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G48910 148 / 5e-42 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G50270 147 / 1e-41 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33170 147 / 2e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G20730 145 / 5e-41 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G18970 142 / 2e-40 MEF20 mitochondrial editing factor 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036736 300 / 4e-100 AT1G26900 574 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031423 162 / 4e-47 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010909 159 / 8e-46 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014298 158 / 2e-45 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029344 155 / 1e-44 AT5G06540 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026006 155 / 2e-44 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024971 154 / 5e-44 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036029 152 / 8e-44 AT5G27110 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010385 152 / 3e-43 AT4G37380 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G012600 178 / 8e-53 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G223900 160 / 5e-47 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G168800 160 / 1e-46 AT2G02980 860 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G466066 157 / 5e-45 AT4G33990 1067 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G065500 156 / 5e-45 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G050200 153 / 8e-44 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G077700 152 / 1e-43 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G044700 153 / 3e-43 AT3G22690 582 / 0.0 unknown protein
Potri.015G034900 149 / 4e-43 AT4G21065 370 / 2e-122 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G006800 152 / 5e-43 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10037193 pacid=23152267 polypeptide=Lus10037193 locus=Lus10037193.g ID=Lus10037193.BGIv1.0 annot-version=v1.0
ATGACACTCGATGCGGTTCTCGGTACAGCTTTGATCGATATGTTTTCGAAATCAGGGTTTCTCGACAAGGCTATCGGCATCTTTGAGAGAATGGTGAGCA
AAGATGTCAAGTCATGGAATGCTATGATCATAGGCTATGGAGTTCACGGCCGGTCGAGGGAAGCTCTTGCGCTCTTGTACAGAATGGAGGGGGAACGATT
CGTTCCGAACGAAGTCACGTTCTTGGCTCTGCTAAGTGCTTGCAGCCACGATGGGATGGTGGCCAAAGCAATGGAGTGTTTCAGGAGGATGGTTGAACGT
TACGGTATGGTACCGAAGGTGGAGCATTACGGGTGCATTACCGATTTGTTAGGTCGTGCAGGGTTACTGAAGGAAGCAAGAGGGCTGATCGAGAGTCTGC
CGGTGATCAACAGCAATGCCACTGCTAGGCGTGCATTGCTTGCGGCGTGCAGAGTGCATGGAGATGTTGAGTTAGGGGAAAAGGTGAAGAGAGTGTTGGT
TGAAATGGACGATCGACATCCTACGGACTAG
AA sequence
>Lus10037193 pacid=23152267 polypeptide=Lus10037193 locus=Lus10037193.g ID=Lus10037193.BGIv1.0 annot-version=v1.0
MTLDAVLGTALIDMFSKSGFLDKAIGIFERMVSKDVKSWNAMIIGYGVHGRSREALALLYRMEGERFVPNEVTFLALLSACSHDGMVAKAMECFRRMVER
YGMVPKVEHYGCITDLLGRAGLLKEARGLIESLPVINSNATARRALLAACRVHGDVELGEKVKRVLVEMDDRHPTD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26900 Pentatricopeptide repeat (PPR)... Lus10037193 0 1
AT5G14100 ABCI11, ATNAP14 ARABIDOPSIS THALIANANON-INTRIN... Lus10032025 13.2 0.7910
AT3G25060 Tetratricopeptide repeat (TPR)... Lus10025915 14.6 0.7738
AT1G49880 EMB3106, AtErv1... EMBRYO DEFECTIVE 3106, Erv1/Al... Lus10011421 18.7 0.7610
AT5G64816 unknown protein Lus10009081 21.8 0.7907
AT2G42680 MBF1A, ATMBF1A ARABIDOPSIS THALIANA MULTIPROT... Lus10000056 26.3 0.7844
AT1G68560 AXY3, TRG1, XYL... thermoinhibition resistant ger... Lus10021679 42.8 0.7509
AT5G06240 EMB2735 embryo defective 2735 (.1) Lus10021327 44.7 0.7326
AT1G29990 PFD6, PDF6 prefoldin 6 (.1) Lus10023313 54.7 0.7456
AT4G38495 unknown protein Lus10029400 58.7 0.7294
AT4G00530 unknown protein Lus10037854 64.5 0.7371

Lus10037193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.