Lus10037194 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26900 110 / 9e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G11290 97 / 4e-24 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 87 / 2e-20 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39350 87 / 3e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G53360 86 / 4e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G20770 86 / 6e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G51320 86 / 7e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G23330 85 / 1e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G29760 84 / 3e-19 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G55740 84 / 3e-19 CRR21 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036736 265 / 9e-87 AT1G26900 574 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10008136 89 / 4e-21 AT5G39350 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016509 87 / 3e-20 AT1G11290 361 / 1e-114 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040776 87 / 3e-20 AT1G11290 272 / 7e-82 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038138 86 / 4e-20 AT4G39952 793 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028855 86 / 6e-20 AT4G21300 873 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025915 84 / 3e-19 AT3G25060 627 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020138 81 / 3e-19 AT3G58590 164 / 1e-46 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010688 83 / 5e-19 AT4G39952 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G178200 91 / 1e-21 AT4G35130 919 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G035100 90 / 2e-21 AT4G13650 397 / 8e-126 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G067000 90 / 3e-21 AT1G18485 500 / 8e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G029500 88 / 7e-21 AT2G04860 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G048800 88 / 8e-21 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G205900 87 / 3e-20 AT2G17210 737 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G059400 85 / 1e-19 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G074000 84 / 2e-19 AT4G39952 892 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G191000 83 / 5e-19 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G044700 83 / 5e-19 AT3G22690 582 / 0.0 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10037194 pacid=23152546 polypeptide=Lus10037194 locus=Lus10037194.g ID=Lus10037194.BGIv1.0 annot-version=v1.0
ATGCTCGAGAGGAATGATTGGGTCTCGTGGAACATTTTGATGGTAGCTTCTCCGCCGGATATGGCCATGGGATTGTTCAAGGAGATGTTAAGACGCTGTG
AAGGTGTCAGTGAGGCTACATTGTTGACTGTCCTGTCGAGTTTCTTCCGGTCGGAGGATTCACTTGGAGGTAAGTCCATCCATGGCTATTACATCAAAAC
CGGGTTATCCTCGAAAGTTAATATCGCGACTGCTCTTGTCGAAATGTACGCTAAAACCGGTAGTTTAGATTCAGGGCGTAGGGTTTTTGACGGGACCATA
GCTAGGGACGTTGTGCTATGGAATTGTATGATACATTCCTATGCCAAAGCTGGACTAATAGATGAAGGAATAGCTTTGCTTAAACTGATGAAAGATGAAC
AAGTGAAGCCAAATTCGTCAACATTAGCAAGTCTTTTTCATCTTGTTCCGCCAATGGATCCATCAAGCTCGGAAAATATCTAA
AA sequence
>Lus10037194 pacid=23152546 polypeptide=Lus10037194 locus=Lus10037194.g ID=Lus10037194.BGIv1.0 annot-version=v1.0
MLERNDWVSWNILMVASPPDMAMGLFKEMLRRCEGVSEATLLTVLSSFFRSEDSLGGKSIHGYYIKTGLSSKVNIATALVEMYAKTGSLDSGRRVFDGTI
ARDVVLWNCMIHSYAKAGLIDEGIALLKLMKDEQVKPNSSTLASLFHLVPPMDPSSSENI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26900 Pentatricopeptide repeat (PPR)... Lus10037194 0 1
AT2G40860 protein kinase family protein ... Lus10024475 35.1 0.6452
AT5G61400 Pentatricopeptide repeat (PPR)... Lus10015716 43.5 0.6503
AT4G32600 RING/U-box superfamily protein... Lus10017750 47.2 0.6532
AT5G06810 Mitochondrial transcription te... Lus10012021 51.6 0.6493
AT2G26790 Pentatricopeptide repeat (PPR)... Lus10020298 56.1 0.6175
AT2G14850 unknown protein Lus10002120 75.8 0.5997
AT5G62670 AHA11 H\(+\)-ATPase 11, H\(+\)-ATPas... Lus10042183 84.9 0.6272
Lus10016250 93.2 0.5698
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10012487 101.8 0.6220
AT4G25330 unknown protein Lus10012314 105.0 0.5858

Lus10037194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.