Lus10037203 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G02760 310 / 1e-110 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
AT1G14400 308 / 2e-109 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2)
AT5G62540 281 / 4e-99 UBC3 ubiquitin-conjugating enzyme 3 (.1)
AT4G27960 146 / 1e-45 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT1G64230 145 / 3e-45 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G53300 145 / 4e-45 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT5G41700 142 / 3e-44 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08690 141 / 8e-44 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT2G16740 140 / 2e-43 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT5G56150 140 / 3e-43 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036727 316 / 7e-113 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10030786 311 / 8e-111 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10013263 310 / 2e-110 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10014942 145 / 2e-45 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 145 / 2e-45 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 145 / 3e-45 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 145 / 3e-45 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 145 / 4e-45 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 145 / 4e-45 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G064400 312 / 2e-111 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.019G039200 310 / 1e-110 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.015G064000 310 / 2e-110 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.003G136200 145 / 3e-45 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 145 / 4e-45 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 144 / 4e-45 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.015G023300 144 / 5e-45 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.012G033000 144 / 5e-45 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.016G138900 144 / 5e-45 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.011G168200 143 / 2e-44 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10037203 pacid=23152566 polypeptide=Lus10037203 locus=Lus10037203.g ID=Lus10037203.BGIv1.0 annot-version=v1.0
ATGACGACTCCTTCGAGGAAGAGACTGATGAGGGACTTCAAGAGGTTGCAACAGGACCCTCCTGCTGGAATCAGCGGTGCTCCCCAAGATAATAATATAC
TGCTCTGGAATGCTGTCATATTTGGGCCTGATGACACCCCGTGGGATGGAGGTACGTTTAAGTTAACACTTCAGTTCAGTGAGGACTACCCAAACAAGCC
GCCAACAGTGCGATTCGTCTCCAGAATGTTCCATCCTAACATTTATGCTGATGGGAGTATTTGCTTGGACATCCTGCAAAACCAATGGAGTCCAATCTAC
GACGTTGCTGCAATACTGACCTCAATCCAGTCTCTGCTTTGCGATCCGAACCCAAACTCCCCTGCGAACTCGGAAGCTGCGAGGATGTTCAGCGAGAACA
AGCGGGAGTACAACAGGAGAGTGCGAGAGATTGTCGAGCAGAGTTGGACTGCTGATTAA
AA sequence
>Lus10037203 pacid=23152566 polypeptide=Lus10037203 locus=Lus10037203.g ID=Lus10037203.BGIv1.0 annot-version=v1.0
MTTPSRKRLMRDFKRLQQDPPAGISGAPQDNNILLWNAVIFGPDDTPWDGGTFKLTLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIY
DVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G02760 ATUBC2 ubiquitin-conjugating enzyme 2... Lus10037203 0 1
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10038827 1.7 0.9405
AT4G31170 Protein kinase superfamily pro... Lus10020374 4.7 0.9163
AT5G39510 ZIG1, SGR4, ATV... SHOOT GRAVITROPSIM 4, VESICLE ... Lus10034696 8.3 0.9313
AT1G56700 Peptidase C15, pyroglutamyl pe... Lus10001521 9.4 0.9293
AT5G16110 unknown protein Lus10033560 10.3 0.8814
AT4G26060 Ribosomal protein L18ae family... Lus10027625 11.3 0.9328
AT4G27880 Protein with RING/U-box and TR... Lus10018110 12.0 0.9131
AT3G24050 GATA GATA1 GATA transcription factor 1 (.... Lus10011762 14.4 0.8893
AT1G35620 ATPDI8, ATPDIL5... ARABIDOPSIS THALIANA PROTEIN D... Lus10016798 14.9 0.9153
AT2G10950 BSD domain-containing protein ... Lus10027706 15.5 0.9250

Lus10037203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.