Lus10037225 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69880 96 / 7e-26 ATH8 thioredoxin H-type 8 (.1)
AT5G39950 90 / 5e-24 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
AT1G59730 89 / 2e-23 ATH7 thioredoxin H-type 7 (.1)
AT5G42980 82 / 9e-21 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
AT1G45145 81 / 2e-20 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
AT3G51030 79 / 5e-20 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
AT1G19730 73 / 2e-17 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
AT3G56420 64 / 1e-13 Thioredoxin superfamily protein (.1)
AT1G76760 60 / 5e-12 ATY1, TRX-Y1 thioredoxin Y1 (.1)
AT1G31020 59 / 9e-12 ATO2 thioredoxin O2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036698 204 / 4e-69 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1)
Lus10037228 128 / 6e-39 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1)
Lus10036695 122 / 3e-36 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Lus10037227 121 / 5e-36 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1)
Lus10036696 120 / 2e-35 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1)
Lus10030666 93 / 4e-25 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Lus10005258 92 / 7e-25 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Lus10041799 86 / 2e-22 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Lus10024293 86 / 3e-22 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G194100 103 / 4e-29 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1)
Potri.017G076700 95 / 6e-26 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Potri.005G232700 81 / 1e-20 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Potri.002G030000 79 / 5e-20 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Potri.007G018000 79 / 6e-20 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Potri.006G110100 64 / 1e-13 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Potri.002G066800 62 / 6e-13 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
Potri.005G193400 62 / 1e-12 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1)
Potri.012G045000 62 / 4e-12 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Potri.016G138800 60 / 4e-12 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10037225 pacid=23152452 polypeptide=Lus10037225 locus=Lus10037225.g ID=Lus10037225.BGIv1.0 annot-version=v1.0
ATGTCTTCAATTATGAGAATCAGCACTACTAGCCTTACTGACCTCCATTCACAACAGAAGCAGCAGCACCAGCAGCTCGTTGAAGTGCGTTCTTTATCAC
ACTGGAAATCCTGCCTTGAATCCTCCAGACGGAACAACAAACTTTTGGTGGTGGATTTCACTGCTGCATGGTGTGGACCATGCCGATTCATGGAGCCAGC
GTTGGGGGAGTTTGCGGCAAAGTATCCTGACATTGAGTTCATCAAGATCGACGTAGACAGGCTACCGTCAGTGGCTAAAGAATTTGAGGTGCAGATAATG
CCAATGGTGGCTGTGGTGAGAGGAGGCAAAGAAGTAGTGGATAAAGTTGAAGGTGTTAAAAAGACTGAGCTTCAGGGCAAGATTGAGAAACACAGGGCAC
AATTCACTTGTTGA
AA sequence
>Lus10037225 pacid=23152452 polypeptide=Lus10037225 locus=Lus10037225.g ID=Lus10037225.BGIv1.0 annot-version=v1.0
MSSIMRISTTSLTDLHSQQKQQHQQLVEVRSLSHWKSCLESSRRNNKLLVVDFTAAWCGPCRFMEPALGEFAAKYPDIEFIKIDVDRLPSVAKEFEVQIM
PMVAVVRGGKEVVDKVEGVKKTELQGKIEKHRAQFTC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69880 ATH8 thioredoxin H-type 8 (.1) Lus10037225 0 1
Lus10038232 2.0 0.9656
AT3G19910 RING/U-box superfamily protein... Lus10029693 2.0 0.9600
AT2G22475 GEM GL2-EXPRESSION MODULATOR, GRAM... Lus10010279 2.6 0.9546
Lus10017954 3.2 0.9502
Lus10025868 3.2 0.9606
Lus10032860 4.6 0.9605
AT3G26880 Plant self-incompatibility pro... Lus10038163 4.9 0.9323
AT2G36650 unknown protein Lus10023883 5.2 0.9532
AT3G51030 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOX... Lus10028349 5.3 0.9413
AT2G36650 unknown protein Lus10014389 5.5 0.9593

Lus10037225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.