Lus10037240 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G14620 236 / 2e-78 XTH10, XTR14 xyloglucan endotransglucosylase/hydrolase 10 (.1)
AT5G57550 145 / 7e-43 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G48070 135 / 4e-39 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT2G06850 134 / 1e-38 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT1G65310 133 / 3e-38 XTH17, XTR1, ATXTH17 xyloglucan endotransglucosylase/hydrolase 17 (.1)
AT4G30290 133 / 3e-38 XTH19, ATXTH19 xyloglucan endotransglucosylase/hydrolase 19 (.1)
AT4G30280 132 / 6e-38 XTH18, ATXTH18 xyloglucan endotransglucosylase/hydrolase 18 (.1)
AT5G13870 132 / 9e-38 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT5G57560 131 / 2e-37 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT3G25050 130 / 3e-37 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035654 311 / 5e-108 AT2G14620 437 / 6e-156 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Lus10020772 141 / 3e-41 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 140 / 5e-41 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 140 / 9e-41 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 137 / 5e-40 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007348 140 / 1e-39 AT3G23730 355 / 2e-121 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 136 / 2e-39 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 135 / 3e-39 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031393 135 / 5e-39 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G083800 237 / 1e-78 AT2G14620 454 / 1e-162 xyloglucan endotransglucosylase/hydrolase 10 (.1)
Potri.003G159700 137 / 1e-39 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.002G060500 137 / 1e-39 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 135 / 5e-39 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G140300 135 / 7e-39 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G146100 134 / 7e-39 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201250 134 / 1e-38 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 134 / 1e-38 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.006G170100 134 / 1e-38 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 134 / 1e-38 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Representative CDS sequence
>Lus10037240 pacid=23152601 polypeptide=Lus10037240 locus=Lus10037240.g ID=Lus10037240.BGIv1.0 annot-version=v1.0
ATGCCCAGAAACCTCAAACTTTCGTCAGCTCTCCTTATTATCACCTTGGTGGTATCATGTCTGCTCCAGATTTCCTCAGGATCCAGCATCGTATCCACTG
GGGATTTCAACAAGGATTTCTATATCACATGGTCTCCTTCCCACGTTAACACATCTGCTGATGGTTCCACAAGAACCTTGAAGCTTGATCAACAGTCCGT
GGACAACCTTACATTCTTCAAACAAACATCTTTTGCCGATGGGATGGATGATTGCGAAGAAAGAATTTATCTTTGGTTCGATCCCACAAAAGACTTCCAC
ACTTACTCTGTTCTATGGAACCTTCACCAAATTGTGTTCATGGTGGACTCTATTCCAATAAGAACCTACAGAAACCATGCAGAGAAAGGGGCGGCATACC
CAACGTTGCAGCCAATGAGCCTCAAGGCGAGCCTATGGAACGGGGACAGCTGGGCGACACGCGGTGGCAAAGACAAAATCGACCGGTCAAAGGCACCCTT
TGTAGATTCATTCAGGAATTACAAGATCGATGCATGTGTTTGGAATGCAGGGAAGAACCCTAACTCTGGTAGGGAAGCAAGTAACTGGTGA
AA sequence
>Lus10037240 pacid=23152601 polypeptide=Lus10037240 locus=Lus10037240.g ID=Lus10037240.BGIv1.0 annot-version=v1.0
MPRNLKLSSALLIITLVVSCLLQISSGSSIVSTGDFNKDFYITWSPSHVNTSADGSTRTLKLDQQSVDNLTFFKQTSFADGMDDCEERIYLWFDPTKDFH
TYSVLWNLHQIVFMVDSIPIRTYRNHAEKGAAYPTLQPMSLKASLWNGDSWATRGGKDKIDRSKAPFVDSFRNYKIDACVWNAGKNPNSGREASNW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G14620 XTH10, XTR14 xyloglucan endotransglucosylas... Lus10037240 0 1
AT5G47510 Sec14p-like phosphatidylinosit... Lus10007464 10.4 0.8255
AT1G13920 Remorin family protein (.1) Lus10036964 23.3 0.7905
AT3G07140 GPI transamidase component Gpi... Lus10038183 32.3 0.7036
AT1G75720 Plant protein of unknown funct... Lus10036971 38.1 0.7851
AT5G17770 CBR1, ATCBR NADH:cytochrome B5 reductase 1... Lus10034869 42.0 0.7806
AT3G18440 ATALMT9 aluminum-activated malate tran... Lus10024711 42.7 0.7183
AT4G24450 PWD, GWD3, ATGW... "phosphoglucan, water dikinase... Lus10032829 47.0 0.7787
AT2G24840 MADS DIA, AGL61 DIANA, AGAMOUS-like 61 (.1) Lus10030824 48.4 0.6969
Lus10018627 52.4 0.7678
AT5G46530 AWPM-19-like family protein (.... Lus10011973 56.4 0.7701

Lus10037240 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.