Lus10037245 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10300 147 / 3e-46 RmlC-like cupins superfamily protein (.1)
AT3G04300 103 / 2e-29 RmlC-like cupins superfamily protein (.1)
AT4G10280 102 / 2e-28 RmlC-like cupins superfamily protein (.1)
AT4G28703 86 / 3e-22 RmlC-like cupins superfamily protein (.1)
AT4G10290 76 / 3e-18 RmlC-like cupins superfamily protein (.1)
AT2G32180 59 / 2e-11 PTAC18 plastid transcriptionally active 18 (.1)
AT2G32650 59 / 2e-11 RmlC-like cupins superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035660 224 / 1e-75 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1)
Lus10035659 158 / 7e-50 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1)
Lus10025947 98 / 1e-26 AT4G28703 132 / 6e-41 RmlC-like cupins superfamily protein (.1)
Lus10014252 94 / 5e-25 AT4G28703 133 / 1e-41 RmlC-like cupins superfamily protein (.1)
Lus10030017 64 / 3e-13 AT2G32180 192 / 4e-64 plastid transcriptionally active 18 (.1)
Lus10035307 57 / 8e-11 AT2G32180 190 / 2e-63 plastid transcriptionally active 18 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G089600 155 / 1e-48 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1)
Potri.002G254800 101 / 3e-28 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1)
Potri.014G156900 60 / 9e-12 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF05899 Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence
>Lus10037245 pacid=23152335 polypeptide=Lus10037245 locus=Lus10037245.g ID=Lus10037245.BGIv1.0 annot-version=v1.0
ATGCACCCACCATCCAACGACTTGCTTCTCCTCCATAGTTCGACGACTATGGCTCGGATGACTGCTCTCCGTCTGCTCGCCTCCGTCTTGATCTCGCTCT
TGGCTCTTACTTCTCAAGCTCAACAAAGCGACATCAACGAACAGAAACTCGTTGATCCTCTGGCAATTCTCACTTACAAGGAGAACCCCCACACTGCCAC
TGTAACAGAAACAGTTGATAAATCGGGAATTAAGGTCGTGAAGAATCCTCCAGACTCGAAGCTTGCTGCACTCGGAGTCCGCTCATGGCCCAGATGGGCA
TTTGCTCCGAGCAAATTTCCATGGACGTATTCGGCAAATGAGACGTCGTATCTATTGGAAGGGAAGGCAAAGGTATACCCAGAGGGATCGGAGCAAGGCA
TTGAGATCGCTGGTGGTGACTTGATTGATTTCCCTAAAGGGATGAGCTGCACTTGGGAAGTTTCTGTTGCCATATACAAGCACTACAAGTTCAATCAGTG
A
AA sequence
>Lus10037245 pacid=23152335 polypeptide=Lus10037245 locus=Lus10037245.g ID=Lus10037245.BGIv1.0 annot-version=v1.0
MHPPSNDLLLLHSSTTMARMTALRLLASVLISLLALTSQAQQSDINEQKLVDPLAILTYKENPHTATVTETVDKSGIKVVKNPPDSKLAALGVRSWPRWA
FAPSKFPWTYSANETSYLLEGKAKVYPEGSEQGIEIAGGDLIDFPKGMSCTWEVSVAIYKHYKFNQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10300 RmlC-like cupins superfamily p... Lus10037245 0 1
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022195 2.4 0.9340
AT1G01800 NAD(P)-binding Rossmann-fold s... Lus10006895 5.5 0.8824
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10022292 6.0 0.9338
Lus10028488 7.1 0.9057
AT1G21390 EMB2170 embryo defective 2170 (.1) Lus10018947 7.3 0.9089
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Lus10033491 10.4 0.9066
Lus10012066 10.7 0.8958
AT5G04760 MYB Duplicated homeodomain-like su... Lus10036413 11.8 0.9167
AT2G02800 Kin2, APK2B protein kinase 2B (.1.2) Lus10021489 16.5 0.9210
Lus10001144 17.7 0.8518

Lus10037245 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.