Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037253 pacid=23152556 polypeptide=Lus10037253 locus=Lus10037253.g ID=Lus10037253.BGIv1.0 annot-version=v1.0 ATGAGCTATTACAACCAGCAGCAACCACCAGTTGGTGTTCCTCCCCCACAAGGTTATCCGCCGGAAGGATACCCTAAAGATGCGTACCCGCCGCCGGGAT ACCCGCAGCAGGGTTATCCACCTCCTGGATATCCACCTCAGCAAGGTTATCCAGCTCCTCCTCCGCCTTATGCGCCTCAGTACGCCCAGCCACCGCCTTA TCAGCAACAACAACAACAGAATAGCAACGCTGGTTGTTTAGAAGGCTGGTTAGGACTCGTCACTGGGATGCTTTCAGATTAA
AA sequence Show only first row Show all	>Lus10037253 pacid=23152556 polypeptide=Lus10037253 locus=Lus10037253.g ID=Lus10037253.BGIv1.0 annot-version=v1.0 MSYYNQQQPPVGVPPPQGYPPEGYPKDAYPPPGYPQQGYPPPGYPPQQGYPAPPPPYAPQYAQPPPYQQQQQQNSNAGCLEGWLGLVTGMLSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037253 [exp]	0	1
AT5G19570			unknown protein		Lus10012977 [exp]	2.2	0.8918
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Lus10013373 [exp]	2.4	0.9006
AT5G11770			NADH-ubiquinone oxidoreductase...		Lus10032155 [exp]	2.8	0.9009
AT5G64813		LIP1	Light Insensitive Period1, Ras...		Lus10005795 [exp]	4.0	0.8661
AT3G44610			Protein kinase superfamily pro...		Lus10006272 [exp]	4.9	0.8920
AT5G08060			unknown protein		Lus10017854 [exp]	6.7	0.8803
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10007533 [exp]	8.3	0.8959
AT3G12650			unknown protein		Lus10015695 [exp]	8.5	0.8836
AT1G51660		ATMKK4, ATMEK4	ARABIDOPSIS THALIANA MITOGEN-A...		Lus10037339 [exp]	11.2	0.8455
AT4G26620			Sucrase/ferredoxin-like family...		Lus10016627 [exp]	12.4	0.7896

Compare expression of checked genes

Lus10037253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.