Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22380 76 / 2e-17 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22360 69 / 3e-15 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22340 68 / 8e-15 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22400 63 / 4e-13 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT1G22370 60 / 4e-12 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT1G78270 49 / 3e-08 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041055 [exp] 117 / 3e-32 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10026912 [exp] 74 / 1e-18 AT1G22360 55 / 6e-12 UDP-glucosyl transferase 85A2 (.1.2) Lus10013921 [exp] 62 / 6e-13 AT1G22380 320 / 3e-107 UDP-glucosyl transferase 85A3 (.1) Lus10013922 [exp] 62 / 2e-12 AT1G22400 533 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032218 [exp] 60 / 7e-12 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10000992 [exp] 59 / 1e-11 AT1G22340 140 / 4e-57 UDP-glucosyl transferase 85A7 (.1) Lus10013919 [exp] 57 / 6e-11 AT1G22380 318 / 2e-106 UDP-glucosyl transferase 85A3 (.1) Lus10013920 [exp] 57 / 9e-11 AT1G22400 488 / 3e-170 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013925 [exp] 54 / 6e-10 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G312600 [exp] 84 / 2e-20 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052166 [exp] 79 / 2e-18 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052300 [exp] 76 / 1e-17 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052232 [exp] 74 / 6e-17 AT1G22360 622 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052400 [exp] 74 / 6e-17 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052100 [exp] 71 / 6e-16 AT1G22360 612 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G021700 [exp] 71 / 1e-15 AT1G22400 524 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G021200 [exp] 71 / 1e-15 AT1G22400 523 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.017G052000 [exp] 69 / 3e-15 AT1G22360 617 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G021000 [exp] 69 / 4e-15 AT1G22360 561 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037262 pacid=23152318 polypeptide=Lus10037262 locus=Lus10037262.g ID=Lus10037262.BGIv1.0 annot-version=v1.0 ATGCACGAAATCCAAGACTTCCCCAAATTCATCATAACCACCGATGCAAATGACACCATGTTCAATTTCCTCCACAGAGAAATCGATCGAACTTCCAGAG CCTCCGCCGTCATAATGAAAACCTTCCACCATCTCGAACTACCCATCCTCGATTCCCTCTTCGCCATCTTCCCTCCAAATCACCCAATCCGCCCTCTCAG CCTAATGCTCGACCAAATGATCACTCCAAACCCTAACAGCAACAACAACAATACCCTTAACTCGATCAGCTAA
AA sequence Show only first row Show all	>Lus10037262 pacid=23152318 polypeptide=Lus10037262 locus=Lus10037262.g ID=Lus10037262.BGIv1.0 annot-version=v1.0 MHEIQDFPKFIITTDANDTMFNFLHREIDRTSRASAVIMKTFHHLELPILDSLFAIFPPNHPIRPLSLMLDQMITPNPNSNNNNTLNSIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10037262 [exp]	0	1
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10029685 [exp]	9.7	0.8940
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10016974 [exp]	14.8	0.9099
AT5G04910			unknown protein		Lus10028878 [exp]	16.2	0.8785
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10014418 [exp]	16.2	0.8964
AT5G43210			Excinuclease ABC, C subunit, N...		Lus10016370 [exp]	16.7	0.8631
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10023226 [exp]	20.3	0.8899
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10023921 [exp]	27.8	0.8941
AT5G58160			actin binding (.1)		Lus10035830 [exp]	33.5	0.8894
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10009916 [exp]	46.4	0.8859
AT1G50680	AP2_ERF		AP2/B3 transcription factor fa...		Lus10036282 [exp]	55.6	0.8583

Compare expression of checked genes

Lus10037262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.