Lus10037274 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10037274 pacid=23152586 polypeptide=Lus10037274 locus=Lus10037274.g ID=Lus10037274.BGIv1.0 annot-version=v1.0
ATGCATTTTGGCTGGCCTTCAAGGATTGACAGGGTCAAGGAAGCTCTAGATGTTAGGGCAGAAATTTCCATGGAGGTCTGTGAAGTCACAGTCCAGACTG
TGGTGTTCTATATCAGGAGTGTGTTTTCATTCTTTTCAGGAATCAGGATCAGTATGGACGTCGCTGCTGTTCTCAACGACAAAAGAAGAGGGAATCTCGA
AGTACTTGACGGGCATTCTCAATGCAATCAGAAAATCACTTTCATGCAAAAAGAGAAAAGGGACGCAGCCATCACATGCTTCAACTTCCAGGTTTGCAGT
TTTAGTTCTGTGGTTGAAATGGTGTTAACATTTTCTATCATGGCTTGGCACACGTTTAGCAAATTGTCCAGAATGGAGGAAGTTTATGACAGCAGGCGAG
ATTGCTATGTGAAAGTAAAGGATACAGCTTGA
AA sequence
>Lus10037274 pacid=23152586 polypeptide=Lus10037274 locus=Lus10037274.g ID=Lus10037274.BGIv1.0 annot-version=v1.0
MHFGWPSRIDRVKEALDVRAEISMEVCEVTVQTVVFYIRSVFSFFSGIRISMDVAAVLNDKRRGNLEVLDGHSQCNQKITFMQKEKRDAAITCFNFQVCS
FSSVVEMVLTFSIMAWHTFSKLSRMEEVYDSRRDCYVKVKDTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10037274 0 1
AT2G17787 unknown protein Lus10013567 6.0 0.8728
AT1G11330 S-locus lectin protein kinase ... Lus10015422 11.7 0.8680
AT1G78070 Transducin/WD40 repeat-like su... Lus10036428 13.2 0.8659
AT3G05580 TOPP9 type one protein phosphatase 9... Lus10031489 14.1 0.8680
AT4G35785 RNA-binding (RRM/RBD/RNP motif... Lus10041854 15.5 0.8590
AT2G17787 unknown protein Lus10017274 16.1 0.8667
AT1G15200 protein-protein interaction re... Lus10023800 18.2 0.8685
AT1G69010 bHLH bHLH102, BIM2 BES1-interacting Myc-like prot... Lus10005091 29.4 0.8597
AT3G52230 unknown protein Lus10038643 33.4 0.8260
Lus10042562 36.1 0.8316

Lus10037274 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.