Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019712 [exp] 40 / 0.0001 AT2G28305 283 / 8e-97 LONELY GUY 1, Putative lysine decarboxylase family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037282 pacid=23152251 polypeptide=Lus10037282 locus=Lus10037282.g ID=Lus10037282.BGIv1.0 annot-version=v1.0 ATGGTTATTGGTGGCATTCTAATGTGTTTCCAAGGTTTTGGAAACCCAATCAGCTTTCTTGTTGAAGCATTATGGAGTGAAGCGAATATCAATGGAAGAA TCGGAACAGAGCTTAGCAAATGCTTCCCATGTAGCTGTAGCAAAGCCAAAACCATTTGTGTTTCAGTGTTTGAGACCTTTGTTGCAGGTGATCACATAAA GACAGTGGAAGTAGACCATGCATGGGAGAGGAGAAATGTTGGCATAGGTAATGGCTTCAAGAAGATCGTTGGGTTTGAAGTCCGGAATGTACAGTCGTTT TGGCATTCTTGTGATGGTAACCCCGGAGTTTACCTGACGGCAACATCACTAAATGTAGTGTCCGTTGAATAG
AA sequence Show only first row Show all	>Lus10037282 pacid=23152251 polypeptide=Lus10037282 locus=Lus10037282.g ID=Lus10037282.BGIv1.0 annot-version=v1.0 MVIGGILMCFQGFGNPISFLVEALWSEANINGRIGTELSKCFPCSCSKAKTICVSVFETFVAGDHIKTVEVDHAWERRNVGIGNGFKKIVGFEVRNVQSF WHSCDGNPGVYLTATSLNVVSVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037282 [exp]	0	1
AT1G50575			Putative lysine decarboxylase ...		Lus10003762 [exp]	7.2	0.8690
					Lus10006003 [exp]	11.5	0.8499
AT5G07910			Leucine-rich repeat (LRR) fami...		Lus10021635 [exp]	17.4	0.8161
AT1G15030			Protein of unknown function (D...		Lus10031598 [exp]	18.7	0.8563
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10042895 [exp]	20.3	0.8565
AT3G16380		PAB6	poly(A) binding protein 6 (.1)		Lus10038840 [exp]	20.4	0.8487
AT1G28560		SRD2	SHOOT REDIFFERENTIATION DEFECT...		Lus10041957 [exp]	20.5	0.8610
AT1G49350			pfkB-like carbohydrate kinase ...		Lus10009862 [exp]	29.7	0.8293
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10030274 [exp]	30.0	0.8543
AT2G36290			alpha/beta-Hydrolases superfam...		Lus10041666 [exp]	31.7	0.8014

Compare expression of checked genes

Lus10037282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.