Lus10037287 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31790 82 / 3e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G74400 62 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18520 62 / 5e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G34400 60 / 2e-10 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G14820 58 / 1e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G55740 57 / 3e-09 CRR21 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G66500 56 / 3e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G11290 56 / 5e-09 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G27610 55 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G19191 54 / 2e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035697 201 / 8e-63 AT1G31790 226 / 1e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000349 87 / 1e-19 AT3G09510 49 / 5e-06 Ribonuclease H-like superfamily protein (.1)
Lus10012727 65 / 5e-12 AT5G65530 457 / 8e-157 Protein kinase superfamily protein (.1)
Lus10036375 61 / 9e-11 AT2G46050 435 / 7e-146 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10004751 59 / 7e-10 AT5G55740 577 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006174 57 / 3e-09 AT1G71460 459 / 2e-157 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10041049 56 / 4e-09 AT1G71460 796 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10006123 56 / 6e-09 AT4G14850 923 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004987 56 / 8e-09 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G155400 67 / 5e-13 AT5G55740 706 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G170300 64 / 6e-12 AT4G18520 717 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G136200 59 / 6e-10 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.011G052300 57 / 2e-09 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G184800 57 / 2e-09 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 56 / 5e-09 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G187800 56 / 5e-09 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G007800 56 / 5e-09 AT3G22150 1088 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G022500 56 / 6e-09 AT5G66500 582 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G086200 55 / 1e-08 AT4G14820 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10037287 pacid=23152362 polypeptide=Lus10037287 locus=Lus10037287.g ID=Lus10037287.BGIv1.0 annot-version=v1.0
ATGGACGATGGTGGAAGCACTGCTCGACAAGTCCATGCAATTGCCATCAAATTACAGGGGGGATTGAATAGGAAGGTTGTTATGATCCAGTGTGGATTGA
TTAAGATGTACGGCAGGTGTGGGTTGGTCCGGTATTCAGAACAGGTATTCGACAGGACGCTCACTGACAAGCAGAGATGTAATGCGCGTTGGAATACGAT
GCTAATGTCCTATTTGCAGAATGGGTTATATGTGGAGGCGTTCAAGCTTCTTTGCAAGATGAAAGCAGCTGCAGTAGAGGTGACTGAGTCATTGGTAAAC
AAAGTCAGAATTGCCTGTGGCTCTGTAAAGGCTGAAGAACAGGGGAAACTGGTGGCCAAACCATCTGTTCTTGTTGCAGGGGAATTAGCATCCTCAATCC
GATGCCCTGTTCTTGTCATGACCGACTGCGTCTCCCTTGTGAGGCTCCTGCATGATGACTCGAGCTCTTTCCACTGGGAGGGAGTGCCTTTAACTACTAA
GATCTCGCGGAGTTTACGTACATCCTCTTATATCACGATTATGTTCCTCCCGCGCAAGGAGAATTTCAAAGTTGATTGGGTTGCTCGTAACTCCTCTGCT
GAATCTGTAGCGTTGGATTGGATTGTTATGTTACCGTCCTCTAAGGTGTAA
AA sequence
>Lus10037287 pacid=23152362 polypeptide=Lus10037287 locus=Lus10037287.g ID=Lus10037287.BGIv1.0 annot-version=v1.0
MDDGGSTARQVHAIAIKLQGGLNRKVVMIQCGLIKMYGRCGLVRYSEQVFDRTLTDKQRCNARWNTMLMSYLQNGLYVEAFKLLCKMKAAAVEVTESLVN
KVRIACGSVKAEEQGKLVAKPSVLVAGELASSIRCPVLVMTDCVSLVRLLHDDSSSFHWEGVPLTTKISRSLRTSSYITIMFLPRKENFKVDWVARNSSA
ESVALDWIVMLPSSKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31790 Tetratricopeptide repeat (TPR)... Lus10037287 0 1
AT4G16260 Glycosyl hydrolase superfamily... Lus10027479 3.2 0.6544
AT1G19640 JMT jasmonic acid carboxyl methylt... Lus10025993 4.9 0.6987
AT2G34160 Alba DNA/RNA-binding protein (... Lus10021222 5.5 0.7285
Lus10034684 17.7 0.6649
AT3G63390 unknown protein Lus10018745 30.9 0.6179
Lus10039897 32.0 0.6741
AT2G30900 TBL43 TRICHOME BIREFRINGENCE-LIKE 43... Lus10020786 41.9 0.6659
AT3G50120 Plant protein of unknown funct... Lus10019324 47.0 0.6606
AT1G60190 AtPUB19 plant U-box 19, ARM repeat sup... Lus10029163 49.4 0.6314
AT3G27470 Protein of unknown function (D... Lus10022287 50.1 0.6434

Lus10037287 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.