Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45880 164 / 1e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G19840 41 / 8e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G78280 41 / 9e-05 transferases, transferring glycosyl groups (.1) AT5G06550 38 / 0.001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035699 [exp] 227 / 2e-75 AT3G45880 461 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10010350 [exp] 42 / 5e-05 AT1G78280 1211 / 0.0 transferases, transferring glycosyl groups (.1) Lus10036482 [exp] 42 / 6e-05 AT1G78280 1194 / 0.0 transferases, transferring glycosyl groups (.1) Lus10000493 [exp] 41 / 9e-05 AT5G19840 545 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10001249 [exp] 39 / 0.0003 AT5G63080 232 / 8e-74 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G025400 [exp] 195 / 1e-62 AT3G45880 417 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G233200 [exp] 193 / 4e-62 AT3G45880 404 / 3e-141 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037290 pacid=23152628 polypeptide=Lus10037290 locus=Lus10037290.g ID=Lus10037290.BGIv1.0 annot-version=v1.0 ATGTACATTCGCAATTATCCTGCTGCTCAGTATTCTTATGATCTGGATCATAGCGGAGAGTTTAGGTTGGAGTTGGATGATCCGGCTAGGAATAAGCCTT GGTGCAGTGTGAATCCTTACCCTACACCAGAGGCTGAAGAAGCGGAAAGGTCAAAGTACCCATTGTATTTCAACAGATCAAAGCCATTTCAATGTACTGT CAAAGCAGGAGAGATTCTTTACCTGCCTAGTATGTGGTTTCATCATGTTCGTCAGAGTCCAGACGAGTGCACTATTGCCGTAAACTACTGGTATGACATG CAGTTCCATATCAAGTATGCTTATTTCAACTTCTTGCAATCAATCCATCATGGTCTCCAAATACATTGA
AA sequence Show only first row Show all	>Lus10037290 pacid=23152628 polypeptide=Lus10037290 locus=Lus10037290.g ID=Lus10037290.BGIv1.0 annot-version=v1.0 MYIRNYPAAQYSYDLDHSGEFRLELDDPARNKPWCSVNPYPTPEAEEAERSKYPLYFNRSKPFQCTVKAGEILYLPSMWFHHVRQSPDECTIAVNYWYDM QFHIKYAYFNFLQSIHHGLQIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45880			2-oxoglutarate (2OG) and Fe(II...		Lus10037290 [exp]	0	1
AT5G53340			Galactosyltransferase family p...		Lus10014945 [exp]	40.9	0.7473
AT2G33100		ATCSLD1	CELLULOSE-SYNTHASE LIKE D1, ce...		Lus10000755 [exp]	61.7	0.7110
AT4G05020		NDB2	NAD(P)H dehydrogenase B2 (.1),...		Lus10020087 [exp]	91.2	0.7258
AT5G54930			AT hook motif-containing prote...		Lus10040754 [exp]	118.7	0.7107
AT4G12010			Disease resistance protein (TI...		Lus10017419 [exp]	163.0	0.6954
AT2G25570			binding (.1.2.3)		Lus10001073 [exp]	222.0	0.6682
AT1G17450			B-block binding subunit of TFI...		Lus10000369 [exp]	251.7	0.6727

Compare expression of checked genes

Lus10037290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.