Lus10037314 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64650 274 / 6e-96 Ribosomal protein L17 family protein (.1)
AT5G09770 274 / 6e-96 Ribosomal protein L17 family protein (.1)
AT3G54210 114 / 5e-32 Ribosomal protein L17 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035729 331 / 2e-118 AT5G09770 271 / 6e-95 Ribosomal protein L17 family protein (.1)
Lus10007002 114 / 3e-32 AT3G54210 244 / 2e-82 Ribosomal protein L17 family protein (.1)
Lus10000382 115 / 4e-32 AT3G54210 245 / 3e-82 Ribosomal protein L17 family protein (.1)
Lus10006999 114 / 2e-31 AT3G54210 248 / 1e-82 Ribosomal protein L17 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G107100 287 / 3e-101 AT5G64650 258 / 1e-89 Ribosomal protein L17 family protein (.1)
Potri.005G061700 277 / 6e-97 AT5G64650 257 / 4e-89 Ribosomal protein L17 family protein (.1)
Potri.006G113500 114 / 3e-32 AT3G54210 253 / 1e-85 Ribosomal protein L17 family protein (.1)
Potri.016G143100 114 / 8e-32 AT3G54210 258 / 7e-88 Ribosomal protein L17 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01196 Ribosomal_L17 Ribosomal protein L17
Representative CDS sequence
>Lus10037314 pacid=23152252 polypeptide=Lus10037314 locus=Lus10037314.g ID=Lus10037314.BGIv1.0 annot-version=v1.0
ATGACGAAGTTCAGGAAGCTAAATCGGCCGGCGGCCCACCGTATGGCCATGTTCAGAACTATGGTTTCACAACTGGTGAAGCACGAGCGCATTGAAACCA
CCGTTGCCAAGGCAAAAGAAATACGCAGGCTTGCTGATAATATGGTGCAGCTTGGCAAAGAGGGTACCCTTCATGCTGCAAGGCAAGCTGGTGCTTTCGT
GAGAGGAGATGATGTCATTCACAAACTATTTACAGAGCTAGCATATCGATACAAGGACAGAGCTGGTGGTTACACAAGGATGCTAAGAACACGCATTAGA
GTCGGTGACGCTGCACCAATGGCCTACATTGAGTTTATCGATAGAGAAAATGAACTGAGACAATCCAAACCACCAATCCCTCAGGCGCCTCAGAGAGCTG
CTTTGGATCCATGGATGAGATCCCAGCTCACCAGGAACTTTGCACCACCCAAGGAGGAAAAGCAATCTGGATGTGATTCCGACATATGA
AA sequence
>Lus10037314 pacid=23152252 polypeptide=Lus10037314 locus=Lus10037314.g ID=Lus10037314.BGIv1.0 annot-version=v1.0
MTKFRKLNRPAAHRMAMFRTMVSQLVKHERIETTVAKAKEIRRLADNMVQLGKEGTLHAARQAGAFVRGDDVIHKLFTELAYRYKDRAGGYTRMLRTRIR
VGDAAPMAYIEFIDRENELRQSKPPIPQAPQRAALDPWMRSQLTRNFAPPKEEKQSGCDSDI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09770 Ribosomal protein L17 family p... Lus10037314 0 1
AT5G09770 Ribosomal protein L17 family p... Lus10035729 1.4 0.9082
AT4G39200 Ribosomal protein S25 family p... Lus10023552 17.2 0.9048
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10010763 19.1 0.9054
AT5G19300 unknown protein Lus10034063 21.4 0.8907
AT5G61030 GR-RBP3 glycine-rich RNA-binding prote... Lus10034685 21.9 0.9012
AT3G56070 ROC2 rotamase cyclophilin 2 (.1.2) Lus10022012 22.2 0.8779
AT4G35850 Pentatricopeptide repeat (PPR)... Lus10022296 26.1 0.8820
AT5G55130 SIR1, CNX5 SIRTINOL RESISTANT 1, "co-fact... Lus10022510 35.2 0.8910
AT5G66860 Ribosomal protein L25/Gln-tRNA... Lus10009338 37.9 0.8926
AT3G26410 TRM11, AtTRM11 tRNA modification 11, methyltr... Lus10025686 40.4 0.8808

Lus10037314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.