Lus10037342 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15330 81 / 6e-19 AtPV42a Cystathionine beta-synthase (CBS) protein (.1)
AT1G80090 69 / 2e-14 AtPV42b Cystathionine beta-synthase (CBS) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029432 152 / 1e-45 AT1G15330 398 / 6e-139 Cystathionine beta-synthase (CBS) protein (.1)
Lus10004227 151 / 4e-45 AT1G15330 418 / 5e-146 Cystathionine beta-synthase (CBS) protein (.1)
Lus10029433 39 / 0.0004 AT3G18150 79 / 8e-16 RNI-like superfamily protein (.1)
Lus10035564 39 / 0.0007 AT3G58900 79 / 1e-16 F-box/RNI-like superfamily protein (.1.2.3.4)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10037342 pacid=23152500 polypeptide=Lus10037342 locus=Lus10037342.g ID=Lus10037342.BGIv1.0 annot-version=v1.0
ATGATGATGATTCAGGACGACAGACGAATATTTGATGATTCAGGACTCAGTTCTCTCCCTGACGATATTTTGATTCGCATTCTAGGCTTCCTCGACACTA
AATCTTCGCATCATAGACTGTATGGAAGTGCTGAGCAGGGGATACACCGAGCACTCGTGCCGGTGGAGAGCCACATGGCGAATGTGGCCGGAGTTGAGCT
TGTGGAGTCGGCTTCAAGCTACAGGATGTTGACCCAGATGGACTTGCTCAACGTCTTCATCCAGGAGACCGAGAATCACCCCGACCATCACGGTGAGCTT
CGAGGCATCATGGTCCGCTCTTTGCGAGACCTTGGAGTCTTGAACGGGTGTGTTTACACCATAGTTGGACGCACCCGAGTCATTGTGCCATCAAGTGCAT
GCGGACCGACCCTTCTTATGTAA
AA sequence
>Lus10037342 pacid=23152500 polypeptide=Lus10037342 locus=Lus10037342.g ID=Lus10037342.BGIv1.0 annot-version=v1.0
MMMIQDDRRIFDDSGLSSLPDDILIRILGFLDTKSSHHRLYGSAEQGIHRALVPVESHMANVAGVELVESASSYRMLTQMDLLNVFIQETENHPDHHGEL
RGIMVRSLRDLGVLNGCVYTIVGRTRVIVPSSACGPTLLM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15330 AtPV42a Cystathionine beta-synthase (C... Lus10037342 0 1
AT3G25820 ATTPS-CIN "terpene synthase-like sequenc... Lus10006356 5.3 0.8427
AT5G27290 unknown protein Lus10018966 8.2 0.8724
AT2G26540 ATUROS, ATDUF3,... ARABIDOPSIS THALIANA UROPORPHY... Lus10032769 10.1 0.8330
AT2G21370 XK1, XK-1 XYLULOSE KINASE 1, xylulose ki... Lus10041956 13.9 0.8708
AT4G18975 Pentatricopeptide repeat (PPR)... Lus10028526 19.9 0.8383
AT1G08980 ATTOC64-I, ATAM... ARABIDOPSIS THALIANA TRANSLOCO... Lus10029941 20.7 0.8639
AT1G53250 unknown protein Lus10028136 21.1 0.8494
AT1G53250 unknown protein Lus10042840 23.9 0.8377
AT1G31170 ATSRX sulfiredoxin (.1.2.3.4) Lus10038354 27.2 0.8318
AT4G12830 alpha/beta-Hydrolases superfam... Lus10002142 28.0 0.8572

Lus10037342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.