Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50380 45 / 5e-07 Prolyl oligopeptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032920 [exp] 45 / 6e-07 AT1G50380 1018 / 0.0 Prolyl oligopeptidase family protein (.1) Lus10015387 [exp] 43 / 2e-06 AT1G50380 1096 / 0.0 Prolyl oligopeptidase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G001300 [exp] 43 / 3e-06 AT1G50380 1149 / 0.0 Prolyl oligopeptidase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037345 pacid=23152345 polypeptide=Lus10037345 locus=Lus10037345.g ID=Lus10037345.BGIv1.0 annot-version=v1.0 ATGGCTGATTGGTCGTGCGCCTCTTCCATTCCGTCAGAGAATGCTTGGACACAAAAAGCTCCAGGAGGTGGTGAAATGTGGCGGCAGTGGTATGAGAATG GTACAGGTTTAGTTGCTTCTTCAGAGGAGAAGTGTATGGATGATAGAGTTGCTGGTGGATTGCTAATTGGAATCGTCACAAGACCTAAAAGCTAA
AA sequence Show only first row Show all	>Lus10037345 pacid=23152345 polypeptide=Lus10037345 locus=Lus10037345.g ID=Lus10037345.BGIv1.0 annot-version=v1.0 MADWSCASSIPSENAWTQKAPGGGEMWRQWYENGTGLVASSEEKCMDDRVAGGLLIGIVTRPKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037345 [exp]	0	1
AT5G59090		ATSBT4.12	subtilase 4.12 (.1.2.3)		Lus10040253 [exp]	2.4	0.8438
AT5G41410	HD	BEL1	BELL 1, POX (plant homeobox) f...		Lus10032292 [exp]	5.3	0.8197
AT4G31805			WRKY family transcription fact...		Lus10024451 [exp]	6.9	0.8236
AT4G31805			WRKY family transcription fact...		Lus10007445 [exp]	10.5	0.8297
AT1G32560		AtLEA4-1	Late Embryogenesis Abundant 4-...		Lus10040088 [exp]	17.7	0.7774
AT1G56430		ATNAS4	ARABIDOPSIS THALIANA NICOTIANA...		Lus10029843 [exp]	20.8	0.7172
					Lus10003899 [exp]	24.5	0.7746
AT5G41410	HD	BEL1	BELL 1, POX (plant homeobox) f...		Lus10024661 [exp]	25.6	0.7796
AT4G01940		ATCNFU1, NFU1	NFU domain protein 1 (.1)		Lus10009999 [exp]	26.7	0.7536
AT5G44620		CYP706A3	"cytochrome P450, family 706, ...		Lus10024575 [exp]	30.6	0.6998

Compare expression of checked genes

Lus10037345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.