Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22875 105 / 1e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041349 [exp] 87 / 5e-24 AT2G27970 154 / 2e-50 CDK-subunit 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G217300 [exp] 91 / 4e-26 AT5G22875 88 / 7e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037369 pacid=23152348 polypeptide=Lus10037369 locus=Lus10037369.g ID=Lus10037369.BGIv1.0 annot-version=v1.0 ATGTCGCGTGGCCGCAACCTCATGGTAGCAGCCGGATTACTAGCCTTTGCGTCTGCTGGAATGGCGTTTCCCTTTTACATGGCGGCAGGGAGAAGTAAGC CAGTGATAGACTCATCAAAGGCATTGCCGCCGCAAGCTACTTTCAGAGGCCCTTACGTCAACACGGGTTCCCGTGATATCGGTCCTGATTTCCAGTCTTA CCCCAAGAAATGA
AA sequence Show only first row Show all	>Lus10037369 pacid=23152348 polypeptide=Lus10037369 locus=Lus10037369.g ID=Lus10037369.BGIv1.0 annot-version=v1.0 MSRGRNLMVAAGLLAFASAGMAFPFYMAAGRSKPVIDSSKALPPQATFRGPYVNTGSRDIGPDFQSYPKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22875			unknown protein		Lus10037369 [exp]	0	1
AT5G58920			unknown protein		Lus10040699 [exp]	7.4	0.8323
AT3G61113			Ubiquitin related modifier 1 (...		Lus10036551 [exp]	7.7	0.8486
AT4G38360		LAZ1	LAZARUS 1, Protein of unknown ...		Lus10022626 [exp]	10.0	0.8518
AT5G62200			Embryo-specific protein 3, (AT...		Lus10027387 [exp]	10.5	0.8430
AT1G61670			Lung seven transmembrane recep...		Lus10025219 [exp]	21.4	0.8114
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10019447 [exp]	24.0	0.8181
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	37.5	0.7921
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10028859 [exp]	60.5	0.7947
AT2G27490		ATCOAE	dephospho-CoA kinase family (....		Lus10013897 [exp]	62.4	0.8036
AT1G12650			unknown protein		Lus10020336 [exp]	63.3	0.7465

Compare expression of checked genes

Lus10037369 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.