Lus10037373 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G16790 125 / 4e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041345 229 / 7e-78 AT2G16790 185 / 3e-60 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G048200 137 / 2e-41 AT2G16790 228 / 1e-76 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10037373 pacid=23152519 polypeptide=Lus10037373 locus=Lus10037373.g ID=Lus10037373.BGIv1.0 annot-version=v1.0
ATGGGGCAAGGCATTCCCTTAACACATGAAGATCGAATCCCATGGCTCCATCTCCTCAAGGACACTCTCCGCCAACACCTCCTGGTAGGGAACACCGTAG
TCCTAGGATGCTCATCTCTTCAGAAATCCTACAGGGACATCCTCAGATCGGCCTATCCCCACCAACATTCATCATCCTGCTGCTGCATCCGGTTCGTTCT
CCTGGATGCCACAGTGGAATTGCTGACCCGCCGCCTCACAGAAAGAGCTCAACAAGGCACCCATTTCATGCCCCCTAAGCTCCTCAGCTCCCAGTTGGAG
CTGCTCCAGATCGACCCCGACGAACCCATTCTCAAAGTAGATGCTTCCCTACCGCCTCTTCACATCGTCTCCACCATCATCTCCTCCTTCCAATCTTCAT
ATGTACCAGACATATTCCTTCCTTCTGTTGCGAAGACTCCGCTTAGCTGA
AA sequence
>Lus10037373 pacid=23152519 polypeptide=Lus10037373 locus=Lus10037373.g ID=Lus10037373.BGIv1.0 annot-version=v1.0
MGQGIPLTHEDRIPWLHLLKDTLRQHLLVGNTVVLGCSSLQKSYRDILRSAYPHQHSSSCCCIRFVLLDATVELLTRRLTERAQQGTHFMPPKLLSSQLE
LLQIDPDEPILKVDASLPPLHIVSTIISSFQSSYVPDIFLPSVAKTPLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G16790 P-loop containing nucleoside t... Lus10037373 0 1
AT2G20410 RNA-binding ASCH domain protei... Lus10006580 5.3 0.8629
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Lus10042727 6.8 0.8804
AT1G54320 LEM3 (ligand-effect modulator ... Lus10001834 19.3 0.8382
AT5G47090 unknown protein Lus10035063 22.1 0.8458
AT5G58040 FIP1[V], ATFIP1... homolog of yeast FIP1 [V], hom... Lus10019609 32.6 0.8260
AT5G53130 ATCNGC1, CNGC1 CYCLIC NUCLEOTIDE-GATED CHANNE... Lus10014925 38.4 0.8240
AT3G51100 unknown protein Lus10041813 40.2 0.8325
Lus10019212 50.6 0.8091
AT4G17720 RNA-binding (RRM/RBD/RNP motif... Lus10000676 58.8 0.8174
AT2G20900 DGK5, ATDGK5 diacylglycerol kinase 5 (.1.2.... Lus10033732 63.1 0.8189

Lus10037373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.