Lus10037377 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36870 406 / 8e-144 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G44990 400 / 2e-141 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT1G10550 207 / 2e-65 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT1G32170 206 / 1e-64 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT1G14720 199 / 6e-62 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT4G14130 197 / 8e-62 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G18990 198 / 2e-61 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT5G57560 196 / 3e-61 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT2G01850 196 / 1e-60 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT3G23730 194 / 2e-60 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041341 548 / 0 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 467 / 2e-167 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10021422 463 / 3e-166 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10023009 378 / 2e-132 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026535 375 / 2e-131 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10001396 374 / 5e-131 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 373 / 2e-130 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026536 327 / 7e-112 AT2G36870 402 / 1e-141 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013823 248 / 2e-82 AT2G36870 301 / 7e-104 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G006600 419 / 1e-148 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.006G122900 408 / 2e-144 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 401 / 8e-142 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G163850 206 / 3e-65 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.003G097300 202 / 5e-63 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.006G071200 200 / 7e-63 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G152400 198 / 7e-62 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.001G136100 199 / 1e-61 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.019G125000 197 / 1e-61 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.006G170100 196 / 3e-61 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10037377 pacid=23152616 polypeptide=Lus10037377 locus=Lus10037377.g ID=Lus10037377.BGIv1.0 annot-version=v1.0
ATGGCTGCCCCTGCTCTTCCTCAAACTCTGCTCTTTATTACACTGCAACTTACTATTCTCGCCACTTTAGTTGTTAACAATGCTGCTGAGTACCCACCTT
CCCCTGCCTACTTCCCAAGCTCCAGAGCTCCTTCTGTTGAGTTCACCCAAATGTTCAGAAACCGTTGGGGTCCTCACCACCAAAAACTTGACCAACACAC
CCTCACTATCTGGCTTGATCAATCCTCAGGAAGTGGGTACCAGTCAATTCAGCCGTATAAATCGGGCTACTTCGGTGCTTCCATCAAACTTCATCCTGGC
TACACTGCTGGAGTCATTACATCTTTCTATCTGTCGAACAACGAGGTGCATCCTGGTACCCACGACGAGATCGACATCGAGTTCCTGGGAACCACACCGG
GGAAGCCTTACACGTTGCAGACCAATGTGTATGTAAGGGGAAGTGGGGATGGGAACATCATAGGCAGAGAAATGCAGTTTCATCTCTGGTTTGACCCTAC
TCAAGATTTCCACCATTATGCAATCCTTTGGGACCCCGATGAGATTATATTTTTTGTGGACGATGTACCAATAAGGAGGTATCCAAGGAAAAGCGATGAG
ACATTCCCGCAGAGGCCAATGTGGGTCTATGGCTCAATTTGGGATGCATCCGACTGGGCCACCGAGCACGGCAAGTACAAAGCTGACTATACGTACCAAC
CCTTTGTTGGCGAGTACCGCGGATTTAAGTTTGGTGGGTGCACGGCCGACCAGGGAACCGTCTGTCGGCCAACACCAGGGTCTCCAACGGGCTCATCGGG
ACTGAGCGAACAGCAAGAAGGTGCCATGGTTTGGGTGCAGAGGAACAGCATGGTGTATGACTACTGTTCAGATCCAGAGAGGGACCACACTCAGACGCCA
GAGTGCTAG
AA sequence
>Lus10037377 pacid=23152616 polypeptide=Lus10037377 locus=Lus10037377.g ID=Lus10037377.BGIv1.0 annot-version=v1.0
MAAPALPQTLLFITLQLTILATLVVNNAAEYPPSPAYFPSSRAPSVEFTQMFRNRWGPHHQKLDQHTLTIWLDQSSGSGYQSIQPYKSGYFGASIKLHPG
YTAGVITSFYLSNNEVHPGTHDEIDIEFLGTTPGKPYTLQTNVYVRGSGDGNIIGREMQFHLWFDPTQDFHHYAILWDPDEIIFFVDDVPIRRYPRKSDE
TFPQRPMWVYGSIWDASDWATEHGKYKADYTYQPFVGEYRGFKFGGCTADQGTVCRPTPGSPTGSSGLSEQQEGAMVWVQRNSMVYDYCSDPERDHTQTP
EC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10037377 0 1
AT5G24600 Protein of unknown function, D... Lus10032916 1.4 0.9521
AT5G44670 Domain of unknown function (DU... Lus10038387 1.7 0.9582
AT1G27930 Protein of unknown function (D... Lus10012537 2.0 0.9476
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10009917 3.0 0.9252
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10036112 3.5 0.9499
AT3G27470 Protein of unknown function (D... Lus10032090 4.2 0.9402
AT5G10770 Eukaryotic aspartyl protease f... Lus10020100 4.5 0.9222
AT5G44670 Domain of unknown function (DU... Lus10036247 4.5 0.9463
AT1G13970 Protein of unknown function (D... Lus10000174 4.9 0.9129
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10002984 5.3 0.9359

Lus10037377 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.