Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29490 56 / 2e-10 Metallopeptidase M24 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032694 [exp] 83 / 8e-20 AT4G29490 687 / 0.0 Metallopeptidase M24 family protein (.1) Lus10008578 [exp] 83 / 1e-19 AT4G29490 768 / 0.0 Metallopeptidase M24 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G149500 [exp] 69 / 8e-15 AT4G29490 767 / 0.0 Metallopeptidase M24 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037379 pacid=23152307 polypeptide=Lus10037379 locus=Lus10037379.g ID=Lus10037379.BGIv1.0 annot-version=v1.0 ATGGAGCTCTACGTCGCCAACCACGAGAAGCTTATCAAATCCATCAGCCAGCATCTCACCGAAGCTTCTCGTCTTCTTCAGGGTTTCGTCCTTCTTCAGG GAGGTGAAGAACAGACTCGTTACTGCATCGATCCCAACATTTCTTATTGCGACCGCTCATCCGCACCAGCCTCAAACCCTACTACACCCCACTCCTCAAT CAACCAATCCGCAAGGGTGGACAAATCCAACGCCAACAAGGACGAGATGGATGGTAGTGGCCGTAAGCACTTGAAGTCGTCGAGGAAGGAGGACTCGAGT GTTGCAACAACAATCCTTGCGTGA
AA sequence Show only first row Show all	>Lus10037379 pacid=23152307 polypeptide=Lus10037379 locus=Lus10037379.g ID=Lus10037379.BGIv1.0 annot-version=v1.0 MELYVANHEKLIKSISQHLTEASRLLQGFVLLQGGEEQTRYCIDPNISYCDRSSAPASNPTTPHSSINQSARVDKSNANKDEMDGSGRKHLKSSRKEDSS VATTILA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29490			Metallopeptidase M24 family pr...		Lus10037379 [exp]	0	1
AT3G28540			P-loop containing nucleoside t...		Lus10007270 [exp]	7.5	0.8882
					Lus10034352 [exp]	11.0	0.8840
AT1G51120	AP2_ERF		AP2/B3 transcription factor fa...		Lus10026212 [exp]	11.7	0.7881
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10029816 [exp]	13.9	0.8687
AT3G24530			AAA-type ATPase family protein...		Lus10005293 [exp]	14.3	0.8718
					Lus10039496 [exp]	14.8	0.8796
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10000559 [exp]	16.1	0.8697
AT5G24670		TAD3, EMB2820	tRNA adenosine deaminase 3, EM...		Lus10040753 [exp]	16.4	0.8662
					Lus10018837 [exp]	16.6	0.8792
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	18.3	0.8733

Compare expression of checked genes

Lus10037379 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.