Lus10037388 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04250 239 / 4e-77 Cysteine proteinases superfamily protein (.1.2)
AT5G03330 232 / 4e-74 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 215 / 3e-69 Cysteine proteinases superfamily protein (.1)
AT3G22260 187 / 4e-58 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 86 / 8e-20 Cysteine proteinases superfamily protein (.1)
AT2G27350 57 / 7e-09 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT5G67170 51 / 4e-07 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038708 270 / 6e-89 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 263 / 7e-86 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 246 / 1e-79 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 244 / 1e-78 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 243 / 2e-78 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 238 / 2e-76 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10010459 190 / 3e-59 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 186 / 6e-57 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 159 / 2e-47 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G094700 305 / 7e-103 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 294 / 2e-98 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 290 / 2e-96 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 271 / 3e-89 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 213 / 7e-69 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.014G140200 211 / 2e-67 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.016G019700 202 / 3e-64 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 199 / 4e-63 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.004G196800 59 / 2e-09 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 58 / 3e-09 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10037388 pacid=23152331 polypeptide=Lus10037388 locus=Lus10037388.g ID=Lus10037388.BGIv1.0 annot-version=v1.0
ATGATTACGTACGAGGATGATGATGTTGTACGATGGGGTTTGCAGCTGTTTGAGAGCGATCCCTACTCTAATTATGGGTATTGCCAAACCCCATTGCAGA
GAGATTTGAACTACTACGATGGACGCCATTTCAAGGGAGAGTATTACGATCCAGAATGTTGTAATGTGGAAGGGCATGACCTAATTGCTCACGCTCTACA
AGAAGAGTTATCGCAGCTTTCGGTTGCTGAGCCACGTGAATCTCCGATCGAAGAGGATCCAGACTCACAAGTGTCCAATTTCCCACCCAATTGGTTTGGC
CAACCCACGGTGGAATATTCTGGGCAAGAAGGTGGCCAAGAAGAGGCTGACAATATGGAACCTTCTAGTTCATGTTCAAGTCCCCAGGAAAACCAGTACT
GCAGGGAGGATTGGTCTTACTCTGGGGACATGACTGATGTGTATGCTTTTGATGGCGAAGTTGGGAAGTGGTTGAATGAAATGGTCCCAATTCCTCATGT
ACCTAGGATTAATGGGGAGATACCTTCAATCGATGACGCAACATTGGATCACCAAAGACTATTAGACAGGCTGCAGGTGTATGATTTAGTAGAGCGTAAA
GTGCAAGGAGATGGAAATTGTCAGTTTCGAGCTCTGTCGGATCAGTTTTACCGAACTCTTGAGCACCACGACTTCGTGAGACAACAAGTTGTAAAGCAGC
TGAAATCTTGTCCTGAGATGTACGAGGGATATGTTCCGATGGGTTACGAAGAGTATATAGAGAAGATGTCCAAGAACGGTGAATGGGGTGATCATGTGAC
TTTACAAGCTGCTGCAGACATGTACGGTGTTAAAATAATTGTTATCACATCCTTCAAGGACACCTGCTATATTGAGATTCTCCCAAATTTCCAAAGATCA
GAACGAGGTACGCTGACTATAGTTATTATCTTTTACCTAAAGACAAGAGGAGCACAAGGATAA
AA sequence
>Lus10037388 pacid=23152331 polypeptide=Lus10037388 locus=Lus10037388.g ID=Lus10037388.BGIv1.0 annot-version=v1.0
MITYEDDDVVRWGLQLFESDPYSNYGYCQTPLQRDLNYYDGRHFKGEYYDPECCNVEGHDLIAHALQEELSQLSVAEPRESPIEEDPDSQVSNFPPNWFG
QPTVEYSGQEGGQEEADNMEPSSSCSSPQENQYCREDWSYSGDMTDVYAFDGEVGKWLNEMVPIPHVPRINGEIPSIDDATLDHQRLLDRLQVYDLVERK
VQGDGNCQFRALSDQFYRTLEHHDFVRQQVVKQLKSCPEMYEGYVPMGYEEYIEKMSKNGEWGDHVTLQAAADMYGVKIIVITSFKDTCYIEILPNFQRS
ERGTLTIVIIFYLKTRGAQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04250 Cysteine proteinases superfami... Lus10037388 0 1
AT3G12170 Chaperone DnaJ-domain superfam... Lus10042353 4.2 0.8864
AT5G50930 Histone superfamily protein (.... Lus10022425 6.3 0.8572
AT3G46320 Histone superfamily protein (.... Lus10019956 6.8 0.8961
AT4G16807 unknown protein Lus10010996 8.3 0.8833
AT2G48100 C2H2ZnF Exonuclease family protein (.1... Lus10029642 10.2 0.7804
AT5G49170 unknown protein Lus10022872 15.6 0.8436
AT5G23420 HMGB6 high-mobility group box 6 (.1.... Lus10041009 15.7 0.8778
AT2G28740 HIS4 histone H4 (.1) Lus10025964 18.7 0.8764
AT5G38070 RING/FYVE/PHD zinc finger supe... Lus10002282 21.6 0.8313
AT1G09200 Histone superfamily protein (.... Lus10031250 24.7 0.8682

Lus10037388 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.