Lus10037402 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60670 301 / 3e-106 Ribosomal protein L11 family protein (.1)
AT2G37190 297 / 6e-105 Ribosomal protein L11 family protein (.1)
AT3G53430 296 / 1e-104 Ribosomal protein L11 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041308 325 / 6e-116 AT5G60670 305 / 6e-108 Ribosomal protein L11 family protein (.1)
Lus10023186 316 / 3e-112 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10026506 316 / 3e-112 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10019935 316 / 3e-112 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10015086 140 / 1e-43 AT3G53430 134 / 5e-42 Ribosomal protein L11 family protein (.1)
Lus10015085 92 / 2e-25 AT5G60670 95 / 4e-27 Ribosomal protein L11 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G145506 310 / 9e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G145504 310 / 9e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G146600 310 / 9e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G145200 310 / 9e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.006G077200 309 / 1e-109 AT2G37190 295 / 7e-104 Ribosomal protein L11 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Representative CDS sequence
>Lus10037402 pacid=23152612 polypeptide=Lus10037402 locus=Lus10037402.g ID=Lus10037402.BGIv1.0 annot-version=v1.0
ATGCCGCCCAAATTCGACCCGTCCCAGGTGGTCGACGTGTTCGTCCGCGTCACCGGTGGCGAAGTAGGTGCCGCCAGTTCCCTCGCCCCGAAGATCGGCC
CTCTCGGTCTGTCCCCGAAGAAAATCGGAGAAGACATCGCGAAGGAGACTACCAAGGAATGGAAGGGCCTCCGCGTAACAGTCAAGCTCACCGTCCAGAA
TCGTCAGGCGAAGGTCACGGTTGTTCCATCTGCCGCCGCTCTGGTCATCAAGGCCTTGAAGGAGCCAGAGAGGGACAGGAAGAAGACCAAGAACATCAAG
CACAACGGAAACATTTCCCTCGACGACGTCATCGAGATCGCCAAGGTGATGAAGTCCAGGTCAATGGCGAAGGATCTCAGCGGCACGATTAAGGAGATTC
TGGGGACTTGCGTATCGGTTGGGTGCACCGTTGATGGAAAGGATCCCAAGGACTTGCAGCAGGAGATTAATGATGCCGATGTCGAGGTGCCGCTTGAATG
A
AA sequence
>Lus10037402 pacid=23152612 polypeptide=Lus10037402 locus=Lus10037402.g ID=Lus10037402.BGIv1.0 annot-version=v1.0
MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETTKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
HNGNISLDDVIEIAKVMKSRSMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEINDADVEVPLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60670 Ribosomal protein L11 family p... Lus10037402 0 1
AT2G07560 AHA6 H\(+\)-ATPase 6, H\(+\)-ATPase... Lus10020149 2.4 0.9245
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032918 2.4 0.9461
AT5G48760 Ribosomal protein L13 family p... Lus10043151 2.8 0.9382
AT5G44500 Small nuclear ribonucleoprotei... Lus10038421 3.2 0.9245
AT3G18190 TCP-1/cpn60 chaperonin family ... Lus10008670 5.2 0.8806
AT1G74050 Ribosomal protein L6 family pr... Lus10038775 6.3 0.9287
AT5G48760 Ribosomal protein L13 family p... Lus10007137 7.1 0.9297
AT5G48760 Ribosomal protein L13 family p... Lus10016679 7.9 0.9234
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 9.9 0.9003
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10013719 10.2 0.9045

Lus10037402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.