Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28030 39 / 3e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52810 37 / 0.0003 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041280 [exp] 62 / 3e-14 AT1G52820 51 / 1e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005776 [exp] 38 / 0.0001 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005774 [exp] 36 / 0.0006 AT1G52790 144 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005773 [exp] 36 / 0.0007 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176100 [exp] 60 / 2e-12 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176000 [exp] 46 / 1e-07 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176500 [exp] 42 / 5e-06 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037429 pacid=23152337 polypeptide=Lus10037429 locus=Lus10037429.g ID=Lus10037429.BGIv1.0 annot-version=v1.0 ATGGGTTCAGAAGAGAGTGCAGATTCCAGAATTCCACTGATCGATCTATCTGGAGAATCTCTGCTTATTGGCTCCCCTGCTTGGGTTGGAGCCTGCACAG AGATCAGGAGAGCCATGGAAGGCTACAGATGCGTCGAAATTGTGTACCGCAAACCATCACCTGAATTCCACAACTCCATCCTGGAATAA
AA sequence Show only first row Show all	>Lus10037429 pacid=23152337 polypeptide=Lus10037429 locus=Lus10037429.g ID=Lus10037429.BGIv1.0 annot-version=v1.0 MGSEESADSRIPLIDLSGESLLIGSPAWVGACTEIRRAMEGYRCVEIVYRKPSPEFHNSILE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28030			2-oxoglutarate (2OG) and Fe(II...		Lus10037429 [exp]	0	1
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10002511 [exp]	3.5	0.8049
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10010140 [exp]	12.7	0.8177
AT1G06410		ATTPSA, ATTPS7	TREHALOSE -6-PHOSPHATASE SYNTH...		Lus10029821 [exp]	22.2	0.7934
AT5G66430			S-adenosyl-L-methionine-depend...		Lus10036547 [exp]	22.7	0.7809
AT3G28345		MDR13, ABCB15	multi-drug resistance 13, ATP-...		Lus10036616 [exp]	26.5	0.6158
AT1G13810			Restriction endonuclease, type...		Lus10033589 [exp]	26.5	0.7633
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10031607 [exp]	28.4	0.7860
AT1G75750		GASA1	GAST1 protein homolog 1 (.1.2)		Lus10034524 [exp]	30.4	0.7840
AT1G24590	AP2_ERF	ESR2, DRNL, SOB...	FOR SUPPRESSOR OF PHYTOCHROMEB...		Lus10017907 [exp]	30.9	0.7523
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019872 [exp]	35.4	0.7805

Compare expression of checked genes

Lus10037429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.