Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61640 43 / 4e-07 AGP20, ATAGP20 arabinogalactan protein 20 (.1) AT5G53250 42 / 4e-07 AGP22, ATAGP22 arabinogalactan protein 22 (.1) AT2G46330 42 / 5e-07 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2) AT5G24105 42 / 6e-07 AGP41 arabinogalactan protein 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023629 [exp] 83 / 4e-23 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10024263 [exp] 83 / 4e-23 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10041273 [exp] 73 / 6e-19 AT3G61640 51 / 3e-10 arabinogalactan protein 20 (.1) Lus10000542 [exp] 40 / 3e-06 AT2G46330 63 / 6e-15 arabinogalactan protein 16 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G078801 [exp] 68 / 5e-17 ND / Potri.014G094800 [exp] 44 / 1e-07 AT3G61640 42 / 1e-06 arabinogalactan protein 20 (.1) Potri.003G136600 [exp] 42 / 5e-07 AT5G53250 55 / 7e-12 arabinogalactan protein 22 (.1) Potri.001G094700 [exp] 42 / 9e-07 AT2G46330 57 / 7e-13 arabinogalactan protein 16 (.1.2) Potri.012G032000 [exp] 40 / 3e-06 AT3G61640 66 / 3e-16 arabinogalactan protein 20 (.1) Potri.015G022600 [exp] 39 / 7e-06 AT5G53250 70 / 4e-18 arabinogalactan protein 22 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [flax] [poplar] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Lus10037436 pacid=23152398 polypeptide=Lus10037436 locus=Lus10037436.g ID=Lus10037436.BGIv1.0 annot-version=v1.0 ATGAGTTCGATGAAATTGTACGCCGCTCCGATCATCGGGTTCCCGATTTTGGCGCTTGCCCAGCTTGGTTATGGACAAGGCTTCGCTCCTTCTCCTGCCG CGGAAGCTCCGTCATCCAGCAATGATGGGGTGGCAATCGATCAAGGAATTGCCTACCTTCTTCTCTTGGTGGCGCTTGGCATCACATACCTCATCCATTG A
AA sequence Show only first row Show all	>Lus10037436 pacid=23152398 polypeptide=Lus10037436 locus=Lus10037436.g ID=Lus10037436.BGIv1.0 annot-version=v1.0 MSSMKLYAAPIIGFPILALAQLGYGQGFAPSPAAEAPSSSNDGVAIDQGIAYLLLLVALGITYLIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53250		AGP22, ATAGP22	arabinogalactan protein 22 (.1...		Lus10037436 [exp]	0	1
AT5G35735			Auxin-responsive family protei...		Lus10012350 [exp]	1.0	0.9296
AT2G26530		AR781	Protein of unknown function (D...		Lus10006479 [exp]	1.4	0.9258
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Lus10003466 [exp]	4.9	0.9135
AT1G76600			unknown protein		Lus10037249 [exp]	5.0	0.9132
AT2G40140	C3HZnF	ATSZF2, CZF1, Z...	\(SALT-INDUCIBLE ZINC FINGER 2...		Lus10007493 [exp]	5.5	0.9228
AT2G30630			P-loop containing nucleoside t...		Lus10041167 [exp]	7.4	0.8788
AT5G13200			GRAM domain family protein (.1...		Lus10031986 [exp]	9.2	0.8785
AT2G30630			P-loop containing nucleoside t...		Lus10021885 [exp]	10.9	0.8587
AT5G24590	NAC	TIP, ANAC091	Arabidopsis NAC domain contain...		Lus10032919 [exp]	11.2	0.9088
AT2G26530		AR781	Protein of unknown function (D...		Lus10032881 [exp]	11.8	0.9049

Compare expression of checked genes

Lus10037436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.